KEGG   Phaeoacremonium minimum: UCRPA7_7699Help
Entry
UCRPA7_7699       CDS       T03102                                 

Definition
(RefSeq) putative succinate dehydrogenase iron-sulfur subunit protein
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
tmn  Phaeoacremonium minimum
Pathway
tmn00020  Citrate cycle (TCA cycle)
tmn00190  Oxidative phosphorylation
tmn01100  Metabolic pathways
tmn01110  Biosynthesis of secondary metabolites
tmn01130  Biosynthesis of antibiotics
tmn01200  Carbon metabolism
Module
tmn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tmn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tmn_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:tmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UCRPA7_7699
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    UCRPA7_7699
Enzymes [BR:tmn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     UCRPA7_7699
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_18 DNA_pol3_tau_4
Motif
Other DBs
NCBI-GeneID: 19328479
NCBI-ProteinID: XP_007918414
UniProt: R8BC23
LinkDB All DBs
Position
Unknown
AA seq 284 aa AA seqDB search
MAALRSTSARILGSARPAFRPATFVRSFASVQESKVQESNASAAPATEAARLKSFQIYRW
NPDQPTEKPRMQTYTLDLNKTGPMVLDALVRIKNELDPTLTFRRSCREGICGSCAMNING
MNTLACLCRIPTESASEVKIYPLPHTYVVKDLVPDLTHFYKQYKSIKPYLQRDTPAPDGK
EYRQSKADRKKLDGLYECILCACCSTSCPSYWWNSEEYLGPAILLQSYRWLADSRDERKA
ERKEALDNSMSLYRCHTILNCTRTCPKGLNPGLAIAEIKKEMSF
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggccgctctccgctctacctctgcccgaattctgggctctgccaggccagccttcagg
ccggcgacctttgttcgctccttcgcatctgtccaggagtcaaaggtccaggagtccaat
gccagtgctgcacccgctaccgaggcggcgcgcctcaagtccttccagatctacagatgg
aatcccgaccagcctaccgagaagccccggatgcagacctacacccttgacctaaacaag
acgggacccatggtgttggacgcgctggtccggatcaagaacgagctcgaccctactctt
accttccgacgaagctgcagagagggtatctgcggaagctgtgcgatgaacatcaacgga
atgaacacactcgcctgcctatgccgtatccctaccgagtctgcctcggaagtcaagatc
taccctctaccgcacacttacgtcgtcaaggatctcgtcccagatctgacgcacttctac
aagcaatacaagtcgatcaagccgtatctgcaaagagatactcctgctcccgacggcaag
gagtaccgccagagtaaggctgaccgaaagaagctggatggtctttacgagtgcattctg
tgcgcgtgctgctctacctcctgcccatcatattggtggaactccgaggagtacctggga
cccgccatccttctccagtcctaccgctggctggccgattcccgagacgagcgcaaggcg
gagcgaaaggaggctctcgacaactccatgagcctgtaccgttgccacaccattctgaac
tgcacaaggacctgcccgaagggtctcaaccccggtctggccatcgccgagatcaagaag
gagatgtctttctag

DBGET integrated database retrieval system