KEGG   Phaeoacremonium minimum: UCRPA7_8196Help
Entry
UCRPA7_8196       CDS       T03102                                 

Definition
(RefSeq) putative glutamate decarboxylase protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
tmn  Phaeoacremonium minimum
Pathway
tmn00250  Alanine, aspartate and glutamate metabolism
tmn00410  beta-Alanine metabolism
tmn00430  Taurine and hypotaurine metabolism
tmn00650  Butanoate metabolism
tmn01100  Metabolic pathways
tmn01110  Biosynthesis of secondary metabolites
Module
tmn_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:tmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    UCRPA7_8196
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UCRPA7_8196
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UCRPA7_8196
   00430 Taurine and hypotaurine metabolism
    UCRPA7_8196
Enzymes [BR:tmn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     UCRPA7_8196
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 19329026
NCBI-ProteinID: XP_007918906
UniProt: R8BAD9
LinkDB All DBs
Position
Unknown
AA seq 510 aa AA seqDB search
MVHLTTIPHPDELDKDIIKEIKKAHLQLANDDDCFTTSVYGSRFAATDLPKHEMPEREMP
KEVAYRMIKDELSLDGNPMLNLASFVTTYMEDEAEKLMTESFSKNFIDYEEYPQSADIQN
RCVSMIGRLFHAPVGAEEGVGAVGTSCVGSSEAIMLAVLAMKRRWKNARKAAGKSTENPN
IVMSSAVQVCWEKATRYFEIEEKLVYCTEGRYVIDPEETVNLHAYFIGTTYTGEYEDVKA
VNDLLVKKGLNVPIHVDAASGGFVAPFVVPGLEWDFRCERVVSINVSGHKYGLVYPGVGW
VVWRSAEFLPQELVFNINYLGADQASFTLNFSKGASQVIGQYYQLIRLGKHGYKAIMSNL
TRTADYLSDSLEALGFIIMSKKSGEGLPLVAFRMTKDEDRNYDEFALAHQLRVRGWVVPA
YTMAPHTNDLKMLRVVVREDFTRPRCDALISDIRQSMCLLDDMDRESIKKQQEFIHKHHT
ASGKATHNHPKYKKEKHSIQGKTGKTHAIC
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggtgcatctgactaccattcctcatccggatgagctggacaaggacatcatcaaggag
atcaagaaggcccatctccagcttgcaaatgatgatgattgcttcaccacttctgtctac
ggctccaggttcgccgctaccgacctaccgaaacacgagatgccagagcgtgagatgccg
aaagaggtggcttatcgaatgatcaaggatgagctcagcctggatggaaatccgatgctc
aaccttgcttcgttcgtcacgacttacatggaagatgaagctgagaagctcatgaccgag
tccttctccaagaactttatcgattacgaggagtacccgcagtctgccgatatccagaac
agatgtgtgtccatgattggccgcctgttccatgcccccgtcggtgcagaagagggagtc
ggtgccgtcggtaccagctgtgttggtagctccgaagctatcatgctcgcggttcttgcc
atgaagagacgctggaagaacgcgagaaaagctgctgggaagtcgactgagaatcctaac
attgtcatgtcatcagctgtacaggtctgctgggagaaggcaactcgatatttcgagatc
gaagagaagcttgtgtattgcaccgagggccgttatgttatcgatccagaggagactgta
aacttgcatgcttactttataggtaccacgtacacgggtgaatacgaggacgtcaaggca
gtaaatgatctcctcgtaaagaagggactgaacgtccctatccatgttgatgcagccagc
ggcggctttgtcgctccgttcgttgtccccggtctagagtgggatttccgttgcgagaga
gttgtctccatcaatgtctcgggacataagtacggcctcgtctatcccggtgtcggctgg
gtcgtttggcggtccgccgaatttcttccgcaggagctagtgttcaacatcaactacctg
ggtgctgaccaggcctccttcacgcttaactttagcaagggtgcctcccaggtcattggt
caatactatcagctcatccgcttgggcaagcatggctacaaagccatcatgtcaaacctg
acccgtaccgcggactacctatctgattctcttgaagcacttggcttcatcatcatgtcc
aagaagtccggcgaaggtcttccgcttgttgcatttcgaatgacgaaggatgaggaccgc
aactatgacgagttcgcccttgctcatcaactacgcgttcgaggctgggtcgtcccggct
tacacgatggctccacacaccaacgacctgaagatgcttcgagttgttgtccgcgaggac
ttcactcgccctcgatgtgacgcactgatctctgatatcaggcagagcatgtgcctcctc
gatgacatggacagggagagcatcaagaagcagcaggagtttatccacaagcaccacacc
gcttccggcaaagccacgcacaaccaccctaagtacaaaaaggagaaacattccattcag
ggaaaaaccggcaagacccatgccatctgctaa

DBGET integrated database retrieval system