KEGG   Phaeoacremonium minimum: UCRPA7_8794Help
Entry
UCRPA7_8794       CDS       T03102                                 

Definition
(RefSeq) putative superoxide dismutase protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tmn  Phaeoacremonium minimum
Pathway
tmn04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:tmn00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    UCRPA7_8794
Enzymes [BR:tmn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     UCRPA7_8794
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF5042
Motif
Other DBs
NCBI-GeneID: 19329680
NCBI-ProteinID: XP_007919495
UniProt: R8B8L0
LinkDB All DBs
Position
Unknown
AA seq 232 aa AA seqDB search
MSSTLLRTSPALRSALRARALKPAAVAASTQFVRGKATLPDLPYDYGALEPYISGKIMEL
HHSKHHQTYVNGLNSALDSIAEAESKGDLTKAAGVAPLLNFHGGGHVNHSLFWENLAPAS
QNGGGEPDGELKNAIDTDFGSFDTLRKQTNAALAGIQGSGWAWLVKDKESGTLGLVTRAN
QDPVTGSLVPLLGIDAWEHAYYLQYQNRKAEYFDAIWNVINWKTVAERFSKA
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgactctcctacgaacttctcccgctctgcggagtgccctccgcgctcgtgct
ctgaagccggctgctgtggccgcaagcacccagtttgtccgcggaaaggctactctgccg
gatcttccgtacgactatggcgcactcgaaccgtacatctccggcaagatcatggagctt
caccacagcaagcaccaccagacctacgtcaacggcctcaacagcgccctcgacagcatt
gcagaggccgagtccaagggcgatctgaccaaagccgccggggtcgcgcccctcctgaac
ttccacggaggcggtcacgtcaaccacagtctcttctgggagaacctcgctcccgccagc
cagaacggtggcggcgaacctgacggcgagctcaagaacgccatcgacactgatttcggt
tcctttgacacgctcaggaagcagacaaatgcggctctggctgggattcagggcagcggc
tgggcatggctggtcaaggacaaggagagcggcacgctgggcctggtgacgcgcgccaac
caggatcccgtcactggatcgctcgtcccgctgctcggcattgacgcctgggagcacgcc
tactacctgcagtaccagaaccgcaaggcagagtactttgatgccatctggaatgtcatc
aactggaagaccgtcgctgagcgcttcagcaaagcataa

DBGET integrated database retrieval system