KEGG   Phaeoacremonium minimum: UCRPA7_991Help
Entry
UCRPA7_991        CDS       T03102                                 

Definition
(RefSeq) putative isocitrate dehydrogenase protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
tmn  Phaeoacremonium minimum
Pathway
tmn00020  Citrate cycle (TCA cycle)
tmn00480  Glutathione metabolism
tmn01100  Metabolic pathways
tmn01110  Biosynthesis of secondary metabolites
tmn01130  Biosynthesis of antibiotics
tmn01200  Carbon metabolism
tmn01210  2-Oxocarboxylic acid metabolism
tmn01230  Biosynthesis of amino acids
tmn04146  Peroxisome
Module
tmn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tmn_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:tmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UCRPA7_991
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    UCRPA7_991
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    UCRPA7_991
Enzymes [BR:tmn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     UCRPA7_991
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 19329931
NCBI-ProteinID: XP_007911771
UniProt: R8BW10
LinkDB All DBs
Position
Unknown
AA seq 415 aa AA seqDB search
MASSIPKIKVKNPVVELDGDEMTRVIWKDIKDKFIFPYLDIDLKYYDLGLEYRDETNDQV
TIDAAEAIKKYSVGVKCATITPDEARVKEFNLKQMWLSPNGTIRNALGGTVFREPIVIPR
IPRLVPGWKKPIIIGRHAFGDQYRAKDKVIPGPGKLSMVYTPADGGAPEEIEVYQFKNGG
GVAQTQYNTDESITGFAHASFKLALDKELPLYMSTKNTILKKYDGRFKDIFQELYDSQYK
KEFEAKGIWYEHRLIDDMVAQMVKSTGGYIMALKNYDGDVQSDIVAQGFGSLGLMTSVLI
TPDGKTFESEAAHGTVTRHYREHQKGKETSTNPIASIFAWTRGLSQRGKLDGQPELVAFA
ESLEKACIDTVDVDGVMTKDLALACGKTAREDYVTTTEYLNAVERRMKKILKEKL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctccatccccaagatcaaggtcaagaacccggtggtggagctggacggtgat
gagatgacccgtgtcatctggaaggacatcaaggacaagttcatcttcccgtacctcgac
atcgacctgaagtactacgacctcggtctcgagtaccgtgatgagaccaatgaccaggtc
acaattgacgccgccgaggcgatcaagaagtacagcgttggtgtcaagtgcgccaccatc
acccctgacgaggctcgtgtcaaggagttcaacttgaagcagatgtggctgtcccccaat
ggcaccatccgtaacgccctgggcggcaccgtcttccgcgagcccattgtgatcccccgc
atcccgcgcctggtgcccgggtggaagaagcccatcatcatcggacgtcacgccttcggc
gaccagtaccgcgccaaggacaaggtgatcccgggccccggcaagctgtccatggtgtac
acgcccgcggacggcggcgcgcccgaggagattgaggtgtaccagttcaagaacggtggc
ggcgtcgcccagacgcagtacaacacggacgagagcatcacgggctttgcccacgccagc
ttcaagctcgcgctcgacaaggagctgccgctgtacatgagcactaagaacaccatcctc
aagaagtacgacggccgcttcaaggacatcttccaggagctgtacgactcccagtacaag
aaggagtttgaggccaagggcatctggtacgagcaccgcctgatcgacgacatggtcgcc
cagatggtcaagagcaccggtggctacatcatggccctgaagaactacgacggcgacgtc
cagtccgacatcgtcgcgcagggcttcggctccctgggcctgatgacgtcggtgctgatc
acgccggacggcaagacgttcgagtcggaggcggcgcacggcaccgtgacgcgccactac
cgcgagcaccagaagggcaaggagacgtcgacgaaccccatcgccagcatcttcgcctgg
acgcgcggcctgtcgcagcgcggcaagctcgacggccagcccgagctcgtcgccttcgcc
gagtcgctcgagaaggcctgcatcgacaccgtcgacgtcgacggcgtcatgaccaaggac
ctggccctcgcctgcggcaagaccgcccgcgaggactacgtcaccaccaccgagtacctc
aacgccgtcgagaggcggatgaagaagatcctcaaggagaagctgtaa

DBGET integrated database retrieval system