KEGG   Tistrella mobilis: TMO_0414Help
Entry
TMO_0414          CDS       T02128                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tmo  Tistrella mobilis
Pathway
tmo00620  Pyruvate metabolism
tmo00680  Methane metabolism
tmo01100  Metabolic pathways
tmo01120  Microbial metabolism in diverse environments
tmo01200  Carbon metabolism
Module
tmo_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TMO_0414
  09102 Energy metabolism
   00680 Methane metabolism
    TMO_0414
Enzymes [BR:tmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     TMO_0414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFK52253
UniProt: I3THL5
LinkDB All DBs
Position
451412..454207
Genome map
AA seq 931 aa AA seqDB search
MSDDDGMTRGPARAANGNGSDAALKDDIRFLGRILGDIVRLNEGAEVFDLVERIRQTSIR
FHRDEDRAAHDELDALLGGMDTVQGLKIVRAFSYFSHLANIAEDQDRLRQSRAGMPDGDG
PAAGTLDYAMARAATDGLDPDRLAAFFDTARVGPVLTAHPTEVRRKSTLTREAEIARLLD
RRDRERPQGEEAAAIEEEVTRAVLTLWQTAMLRRTRLTVIDEVVNGLSYYDETFLTEVPA
VHARVEDMLARRAGSTAEARAGVASFLKMGSWIGGDRDGNPFVTADVLRTTMRLHTRQAM
KFYLAELHELGAELSLSATLVPVSDDLAALAAASPVTPEHQRQEPYRLAVAGIHARMAAT
AEALDAADAVTRPVPAAPRYADPAGLARDLDVVHESLVANGSVLLARGRLRRLRRAVDCF
GFHLAVLDLRQNSAVHERTVAELLEVAAPGTDYLSLDEEARIAVLERELATTRPLVSPFA
KYCEETTAEFAIFAEAAATHRRLGPQAIENVIISKTDGASDLLELALLLKEVGLVRPDGT
AAVNIVPLFETIADLRAAPQIMRRVFACPAYRRLVASRGEMQEVMLGYSDSNKDGGFVTS
RWELYKAETELVACFREAGVALRLFHGRGGSVGRGGGSAYDAILAQPAGAVGGRIRVTEQ
GEIISSKYANPGLGRRNLETFVAATLEASLLPQPACADLEADMAAMEELSDTAFTAYRAL
VYETPGFEDYFWASTVITEIASLNIGSRPASRSRTRRIEDLRAIPWVFSWSQCRAMLPGW
YGFGAAVTAWRDRHGEAGLDRLRRMYRDWPFFTTLLSNMEMVLAKTSMAIASRYAELVPD
EALREAVFGRIRAEWQSSEAALLAITGQTMVLERTPQLARSIRDRFPYLDPLNHVQVEML
RQHRSEAGSDRHLSGIHLTINGISAGLRNSG
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacgacgacggcatgacgcgcggtcccgccagggcggccaacggcaacgggtcc
gatgcagctctgaaggacgatatccgcttcctcggccggatcctgggcgacatcgtccgc
ctcaacgagggggcggaggtcttcgatctggtggagcggatccgccagacatcgatccgc
ttccatcgcgacgaggatcgtgccgcgcatgacgaactcgatgcgctgctcggcggcatg
gacacggtgcaggggctgaagatcgtccgtgccttcagctatttctcccatctcgccaac
atcgccgaggatcaggaccggttgcgccagtcgcgcgccggcatgcccgacggcgacggt
ccggcggccggaacgctcgactatgcgatggcgcgcgcggcgaccgacgggctcgatccc
gaccggctcgcggcctttttcgacaccgcgcgggtggggccggtgctgaccgcccatccg
accgaggtgcgccgcaagagcacgctgacgcgcgaggcggaaatcgcccgcctgctcgac
cgtcgcgaccgcgagcggccgcagggcgaagaggcggcggcgatcgaggaagaggtcacc
cgcgcggtgctcaccctctggcagactgccatgctgcgccgcacccgcctgaccgtgatc
gacgaagtggtcaacgggctcagctattacgacgagaccttcctgaccgaggtgccggcc
gttcacgcccgggtggaagacatgctcgcccgccgcgccggcagcaccgccgaggcgcgg
gcgggtgtcgcctcgttcctgaagatgggcagctggatcggcggcgaccgcgacggcaac
ccgttcgtgaccgccgacgtgttgcgcacgaccatgcggctgcacacccgccaggcgatg
aaattctatcttgccgaattgcacgaacttggggccgaactctcgctgtcggcgacgctg
gtgccggtgagcgacgatctggcggcactggctgcggcctcgccggtgacgcccgagcat
cagcgccaggaaccctatcgcctggcggtggccggcattcatgcccggatggcggcgacg
gctgaggcgctcgacgcggccgatgcggtgacccgcccggtgcccgcggcgccgcgctat
gccgatccggccggacttgcccgggatctcgacgtcgttcatgagagcctggtggccaat
ggctcggttctgctcgcccgcggccggctgcggcgtctgaggcgggcggtcgactgtttc
ggcttccatctggcggtgctcgatctgcgccagaattcggcggtgcatgagcgcacggtg
gccgaactgctggaggtggccgctcccggcaccgactatctgtcgctggacgaagaggca
cgcatcgcggttctggagcgcgagcttgcgaccacccggccgctggtgtcgcccttcgca
aaatattgcgaagagaccacggccgaattcgcaatcttcgcagaggcggcggcgacccat
cgtcgcctcgggccccaggcgatcgagaacgtgatcatctcgaagaccgacggggcctcg
gacctgctggaactggcgctgctgctgaaggaggtcgggctggtgcggcccgacggaacc
gccgcggtgaatatcgtaccgctgttcgaaaccatcgccgacctcagggccgcgccccag
atcatgcggcgggtctttgcctgcccggcctatcgccgtctcgtcgcctcgcgcggcgag
atgcaggaggtcatgctgggatattccgacagcaacaaggatggcggcttcgtcacctcg
cgctgggaactctacaaggcggagacggagctggtcgcctgcttccgcgaggccggggtg
gcgctgcgcctgttccacgggcgcggcggctcggtcggccggggcggcggatcggcctat
gacgcgatcctggcccagccggccggcgctgtgggcggccggatccgggtcaccgaacag
ggcgagatcatctccagcaaatacgccaatccgggcctcggccggcgcaacctcgaaacc
ttcgtcgccgccacgctggaagcgagccttctgccgcagccggcctgcgccgacctcgag
gccgacatggcggcgatggaagagctgtccgacaccgcctttaccgcctatcgggccctc
gtctacgaaacgcccggctttgaagactatttctgggcctcgaccgtcatcaccgagatc
gcctcgctcaatatcggcagtcgtccggcctcgcgcagccgcacgcggcggatcgaggat
ctgcgggcgatcccctgggtgttctcgtggtcgcagtgtcgggcgatgctgcccggctgg
tacgggttcggggcggcggtgaccgcctggcgtgaccgtcatggcgaggcagggctcgac
cggttgcggcgcatgtatcgcgactggcccttcttcaccacgctgctgtcgaacatggag
atggtgctggccaagaccagtatggcgatcgcatcccgctatgccgaactggtgcccgac
gaggcgctgcgcgaagcggtgttcggccggatccgtgccgaatggcagtcgtccgaggcg
gcacttctggcgatcaccggccagacgatggtgctggagcggacgccgcagctggcgcgg
tcgatccgcgaccgcttcccctatctggatccgctgaaccatgttcaggtcgaaatgctg
cgccagcaccggtcggaggcgggcagcgaccgccatctctccggcatccatctcaccatc
aacgggatctcggccgggctgcgcaacagtggctga

DBGET integrated database retrieval system