KEGG   Tistrella mobilis: TMO_1136Help
Entry
TMO_1136          CDS       T02128                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
tmo  Tistrella mobilis
Pathway
tmo00020  Citrate cycle (TCA cycle)
tmo00480  Glutathione metabolism
tmo01100  Metabolic pathways
tmo01110  Biosynthesis of secondary metabolites
tmo01120  Microbial metabolism in diverse environments
tmo01130  Biosynthesis of antibiotics
tmo01200  Carbon metabolism
tmo01210  2-Oxocarboxylic acid metabolism
tmo01230  Biosynthesis of amino acids
Module
tmo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tmo_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:tmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TMO_1136
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TMO_1136
Enzymes [BR:tmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     TMO_1136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: AFK52975
UniProt: I3TJN7
LinkDB All DBs
Position
complement(1251296..1252543)
Genome map
AA seq 415 aa AA seqDB search
MPRIAEEIVRMTKIKVANPVVELDGDEMTRIIWRFIKDKLILPYLDVDLLYYDLGVEHRD
ATNDKVTVDAAEAIAKHGVGVKCATITPDEARVEEFKLKQMWKSPNGTIRNILGGTVFRE
PIICRNVPRLVPGWTQPIVIGRHAFGDQYRATDFKVPGKGTLTVRFQPEDGGEAIEYEVF
KFPGSGVAMAMYNLDESIRGFARACMNYGLQRGYPVYLSTKNTILKAYDGRFKDLFQEVF
DAEFADQFKAAGIVYEHRLIDDMVASALKWDGGFVWACKNYDGDVQSDTVAQGFGSLGLM
TSVLMTPDGKTVEAEAAHGTVTRHFREHQKGRETSTNPIASIFAWTRGLGYRGKFDGNDA
LIGFAETLERVCVETVEAGHMTKDLAILVGKDQAWLNTNAFLDKIDENLKKAMAS
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcgcatcgccgaggagatcgtccgcatgaccaagatcaaggtcgccaatcctgtc
gtcgaactggacggtgacgagatgacccgcatcatctggcggttcatcaaggacaagctg
atcctgccctatctcgacgtcgaccttctctactacgatctcggcgtcgagcatcgcgac
gcgaccaacgacaaggtgacggtggacgccgccgaggcgatcgccaagcacggcgtcggc
gtgaagtgcgcgaccatcacccccgacgaggcccgcgtcgaggagttcaagctgaagcag
atgtggaagtcgccgaacggcaccatccgcaacatcctgggtggcaccgtcttccgcgag
ccgatcatctgccgcaacgtgccgcgcctggtgccgggctggacccagccgatcgtgatc
ggccgtcatgcctttggcgaccagtatcgcgccaccgacttcaaggtgccgggcaagggc
accctgaccgttcgcttccagccggaagacggcggcgaggcgatcgagtacgaggtgttc
aagttcccgggctcgggcgtcgccatggcgatgtacaacctggacgagtcgatccgcggc
ttcgcgcgcgcctgcatgaattacggcctgcagcgcggctatccggtgtatctgtcgacc
aagaacacgatcctgaaggcctatgacggccgcttcaaggacctgttccaggaggtcttc
gacgccgagttcgccgaccagttcaaggccgccggcatcgtctacgagcatcgcctgatc
gacgacatggtcgcctcggccctgaagtgggacggcggtttcgtctgggcctgcaagaac
tatgacggtgacgtgcagtccgacaccgtcgcccagggcttcggctcgctgggtctgatg
acctcggtgctgatgacgccggacggaaagaccgtggaggccgaggccgcccatggcacc
gtcacccgtcatttccgcgagcaccagaagggccgcgagacctcgaccaacccgatcgcc
tcgatcttcgcctggacccggggcctcggctatcgcggcaagttcgacggcaacgacgcc
ctgatcggcttcgccgagaccctggagcgggtctgcgtcgagaccgtcgaggccggccac
atgaccaaggatctggcgatcctggtcggcaaggatcaggcgtggctcaacaccaacgcc
ttcctcgacaagatcgacgagaacctcaagaaggccatggcttcctga

DBGET integrated database retrieval system