KEGG   Tistrella mobilis: TMO_b0104Help
Entry
TMO_b0104         CDS       T02128                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
tmo  Tistrella mobilis
Pathway
tmo00564  Glycerophospholipid metabolism
tmo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TMO_b0104
Enzymes [BR:tmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     TMO_b0104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 STPPase_N FAD_oxidored NAD_binding_8 FAD_binding_2 GIDA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AFK56112
UniProt: I3TTM4
LinkDB All DBs
Position
pTM2:complement(109586..111127)
Genome map
AA seq 513 aa AA seqDB search
MTGDPVHDIFVIGGGINGCGIARDAAGRGYSVALAEMNDLASGTSSGSTKLIHGGLRYLE
HYEFRLVREALMEREVLWRNAPHIIWPMRFVLPHHKGLRPRWLLRLGLFLYDHIGGRKQL
PATRTLDLRSDPAAKPLKPLFRTAFEYSDCWVNDARLVVLNAMDAAARGVELMVRSRVTS
ARREGELWIVTVQSVDHPEVTRSFRARMLINAAGPWVDQVLQGTLARNDVHNVRLVQGSH
IVVRAKFNDPRAFFFQNSDGRIIFAIPYEDDFTLIGTTDQDFKGDPKDIRITEGEIDYLC
AAASEYFAEPVRREDIVWTYSGVRPLYDDGASKAQEATRDYVLKVEHGPDAPGNGAPMLN
VFGGKITTYRRLAEAALEKIEAELGARGPAWTATATLPGGDFPATGFEAELARLRAEYGF
LDDGFGRRLVRLYGTRARMILGSARSKADLGRDFGADLTESEIRYLVTHEWARTADDVLW
RRTKRGLHLSEDQRAAVDDFMHSLPVTGIAAAE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggcgatccggtccatgacattttcgtcatcggcggcggcataaacggctgcggc
atcgcgcgtgatgctgccgggcgcggctattcggtcgcgctggccgagatgaatgatctc
gcctcgggcacctcttccggctccaccaagctgatccatggcgggctgcgctatctggaa
cattatgaattccggctggtgcgtgaggcgctgatggagcgcgaggtgctgtggcgcaat
gccccgcacatcatctggccgatgcgcttcgtgctgccccatcacaaggggctcaggccg
cgctggctgctgcggctgggcctgttcctctacgaccatatcggcggccgcaagcagctg
cccgcgacccggacgctggatcttcgcagcgatcccgccgcgaaaccgctgaagccgctg
ttccgaaccgctttcgaatattccgactgctgggtgaacgatgcccggctggtggtgctg
aacgccatggatgccgccgcccgcggcgtggagctgatggtccgcagccgcgtgacctcg
gcgcggcgcgagggcgagctttggatcgtgaccgtccagagcgtcgaccatccggaggtg
acccgcagctttcgtgcgcgcatgctgatcaatgccgccggcccctgggttgatcaggtg
ctgcagggcacgctggcccgcaacgacgtccacaatgtccgcctggttcagggcagccac
atcgtggtgcgtgcgaagttcaacgatccgcgcgccttcttcttccagaattccgacggc
cggatcatcttcgccatcccctatgaagacgacttcaccctgatcggcaccaccgaccag
gatttcaagggcgacccgaaggacatccggatcaccgaaggcgagatcgactatctttgt
gccgcggccagcgagtatttcgccgagccagtgcggcgcgaggacatcgtctggacctat
tccggcgtgcggccgctttatgacgacggcgcgtcgaaggcgcaggaagccacgcgcgac
tatgtgctgaaggtggagcacgggccggacgcgcccggcaacggcgcgccgatgctgaac
gtcttcggcggcaagatcaccacctatcggcgcctggccgaggcggcgctggagaagatc
gaggcggagctgggcgcccgcggcccggcatggaccgccaccgccaccctgcccggcggc
gacttccccgccaccggtttcgaggccgagcttgcccggctgcgtgccgaatacggcttc
ctggacgacggttttggccgcagactggtgaggctgtatggcacacgggcgcggatgatc
cttggatccgcgcgaagcaaggcggatctggggcgcgatttcggtgcggatctgaccgaa
agcgaaatccgctatctggtgacccacgaatgggcgcggacggccgacgatgttctgtgg
cggcgcaccaagcgcggcctgcatctgtcggaagaccagcgggcagccgtggacgacttc
atgcacagcctgcccgtcaccggcattgccgccgcagaatga

DBGET integrated database retrieval system