KEGG   Tistrella mobilis: TMO_c0238Help
Entry
TMO_c0238         CDS       T02128                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tmo  Tistrella mobilis
Pathway
tmo00473  D-Alanine metabolism
tmo00550  Peptidoglycan biosynthesis
tmo01100  Metabolic pathways
tmo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tmo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    TMO_c0238
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TMO_c0238
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    TMO_c0238
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tmo01011]
    TMO_c0238
Enzymes [BR:tmo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     TMO_c0238
Peptidoglycan biosynthesis and degradation proteins [BR:tmo01011]
 Precursor biosynthesis
  Amino acid ligase
   TMO_c0238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 ATP-grasp NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AFK56848
UniProt: I3TVR0
LinkDB All DBs
Position
pTM3:complement(255714..256628)
Genome map
AA seq 304 aa AA seqDB search
MTTQHVAVLMGGMSAEREVSLTSGRACAEALRGEGYRVTEIDAGADLGAKLAEIRPDVVF
NALHGRFGEDGCVQGVMNLMRLPYTHSGLLASAIAMDKPVAKRLYAAAGLPVAEDRVMHI
DEIGREHPMAVPYVLKPAQEGSSVGVRIVRDESETPLGNRSWTHGPVVLVERYIPGRELT
VGVMDGRALGLTEIRPVQNFYDYEAKYTDGRAVHLVPAPVPEDLAVRAKEIAEAAHRALG
CRGVSRADLRWDDTKPGTEGLILLEVNTQPGMTPLSLVPEQAAAVGIAFGPLVRWMVEHA
ACDA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcagcatgtggcggtactgatgggcggcatgtcggcggaacgcgaggtttcg
ctgaccagcggccgcgcctgtgccgaggcgctgcgcggcgagggctatcgggtgaccgag
atcgatgccggtgccgaccttggtgcgaagctggccgagatccgccccgatgtggtgttc
aacgccctgcatggccgcttcggcgaggatggctgcgtgcagggcgtgatgaacctgatg
cggctgccttatacccattccggcctgctggcatccgccatcgccatggacaagccggtc
gccaagcggctctacgccgccgccggcctgccggtggccgaggatcgggtgatgcatatc
gacgagatcggccgcgagcatccgatggcggtgccctatgtgctgaagcccgcccaggag
gggtcgagcgtcggcgtgcggatcgtgcgcgacgaaagcgagaccccgctcggcaaccgc
agctggacccacggtcccgtggtgctggtggagcgttacatccccggccgcgagctgacg
gtcggcgtgatggacggcagggcgctggggctgaccgagatccggccggtgcagaacttc
tacgactacgaggccaagtacaccgacggccgcgccgtgcatctggtgcccgcacccgtg
cccgaggacctggccgtgcgggcgaaagagattgccgaggcggcccatcgggcgctcggc
tgccgcggtgtcagccgcgcggatctgcgctgggacgataccaaacccggcaccgagggg
ctgatcctgctggaggtgaacacccagccgggcatgacgccgctgtcgctggtacccgag
caggccgccgccgtggggatcgcgttcgggcctttggtcagatggatggtggagcacgct
gcatgcgacgcctga

DBGET integrated database retrieval system