KEGG   Tistrella mobilis: TMO_c0733Help
Entry
TMO_c0733         CDS       T02128                                 

Definition
(GenBank) acetyl-CoA carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
tmo  Tistrella mobilis
Pathway
tmo00061  Fatty acid biosynthesis
tmo00620  Pyruvate metabolism
tmo00640  Propanoate metabolism
tmo01100  Metabolic pathways
tmo01110  Biosynthesis of secondary metabolites
tmo01120  Microbial metabolism in diverse environments
tmo01130  Biosynthesis of antibiotics
tmo01200  Carbon metabolism
tmo01212  Fatty acid metabolism
Module
tmo_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:tmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TMO_c0733
   00640 Propanoate metabolism
    TMO_c0733
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    TMO_c0733
Enzymes [BR:tmo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     TMO_c0733
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     TMO_c0733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 ATP-grasp_5 AP_endonuc_2 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AFK57343
UniProt: I3TX55
LinkDB All DBs
Position
pTM3:874221..875564
Genome map
AA seq 447 aa AA seqDB search
MFEKVLIANRGEIALRVHRACQEMGIRTVAVHSTADADAMHVRLADESVCIGPAPARNSY
LNIPAIIAAAEITGAEAVHPGYGFLSENAQFAEIVEAHGLTFIGPTPDHIRLMGDKIEAK
RAARELGLPLVPGTDGPVTDEAEAMKIAREIGFPVLVKAAAGGGGRGMKVAESAEGLREA
LQTARAEAKAAFGSDAVYLEKYLANPRHIEIQILCDTFGTVVHLGERDCSLQRRHQKVLE
EAPSPAIDAADRARMGEIVANAMRKLGYRGVGTVEFLYENGEFYFIEMNTRLQVEHPITE
AITGIDLVREQIRVAAGQPLGFTQDDVRVQGHAIECRINAENSETFAPSPGLVDTYHAPG
GLGVRVDSGLYQGYRIPPYYDSLIAKLVVHGRNRNECIMRLRRALEEYVVGGIDTTLPLH
QRIARHPDFVDGVYDIRWLEALVANRG
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagaaggtgctgatcgccaatcgcggcgaaatcgcattgcgcgtccatcgcgcc
tgccaggagatgggcatccgcaccgttgcggtccattccaccgccgatgccgatgccatg
catgtccgtctcgccgacgagagcgtgtgcatcggcccggcgcccgcgcgcaattcctat
ctgaacatcccggcgatcatcgccgccgccgaaatcaccggcgccgaggcggtgcatccg
ggctatggcttcctgtccgagaacgcccagttcgccgagatcgtcgaggcccacggcctg
accttcatcggccccaccccggaccatatccggctgatgggcgacaagatcgaggccaag
cgcgcggccagggagctgggcctgccgctggtgcccggcaccgacgggccggtgacggac
gaagccgaggcgatgaagatcgcccgcgagatcggctttccggtgctggtcaaggccgcc
gccggcggtggcggccgcggcatgaaggtggccgaaagcgccgagggcctgcgcgaggca
ctgcagaccgcccgcgccgaggccaaggccgctttcggatcggatgcggtctatcttgag
aagtatctcgcaaatccgcgccatatcgagatccagatcctctgcgacaccttcgggacc
gtggtgcatctgggcgagcgcgactgttctctgcagcgccgccatcagaaggtgctggaa
gaggcgccgtcgccggcgatcgatgcggccgaccgcgcccgcatgggcgagatcgtcgcc
aatgccatgcgcaagctgggctatcgcggcgtcggcacggtggagttcctctacgagaac
ggcgagttctacttcatcgagatgaacacccgcctgcaggtggagcatccgatcaccgag
gcgatcaccggcatcgatctggtgcgcgagcagatccgggtcgccgccggccagccgctg
ggcttcacccaggacgacgtgcgcgtccagggccatgccatcgagtgccggatcaacgcc
gagaactccgagaccttcgccccctcgccggggctggtcgacacctatcacgccccgggc
gggctgggggtgcgcgtggacagcggcctctatcagggctatcgcatcccgccctattac
gacagcctgatcgccaagctggtggtccatggccgcaaccgcaacgagtgcatcatgcgg
ctgcgccgggcgctggaggaatatgtcgtgggcggtatcgacaccaccctgcccctgcat
cagcgcatcgcccgccatccggatttcgtcgacggcgtctacgacatccgctggctggag
gccctggtcgccaatcgcggctga

DBGET integrated database retrieval system