KEGG   Thermotoga maritima Tma100: THMB_0418Help
Entry
THMB_0418         CDS       T03900                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K22231  scyllo-inosose 3-dehydrogenase [EC:1.1.1.-]
Organism
tmq  Thermotoga maritima Tma100
Pathway
tmq00562  Inositol phosphate metabolism
tmq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    THMB_0418
Enzymes [BR:tmq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     THMB_0418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 FAD_binding_3 Pyr_redox_3 ADH_N_assoc Pyr_redox TrkA_N
Motif
Other DBs
NCBI-ProteinID: AKE30080
LinkDB All DBs
Structure
PDB: 

Position
429884..431071
Genome map
AA seq 395 aa AA seqDB search
MRAVRLHAKWDPRPEFKLGPKDIEGKLTWLGSKVWRYPEVRVEEVPEPRIEKPTEIIIKV
KACGICGSDVHMAQTDEEGYILYPGLTGFPVTLGHEFSGVVVEAGPEAINRRTNKRFEIG
EPVCAEEMLWCGHCRPCAEGFPNHCENLNELGFNVDGAFAEYVKVDAKYAWSLRELEGVY
EGDRLFLAGSLVEPTSVAYNAVIVRGGGIRPGDNVVILGGGPIGLAAVAILKHAGASKVI
LSEPSEVRRNLAKELGADHVIDPTKENFVEAVLDYTNGLGAKLFLEATGVPQLVWPQIEE
VIWRARGINATVAIVARADAKIPLTGEVFQVRRAQIVGSQGHSGHGTFPRVISLMASGMD
MTKIISKTVSMEEIPEYIKRLQTDKSLVKVTMLNE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagggctgtcaggcttcacgcgaagtgggatccaaggccggagtttaagctcggtcca
aaagacattgaggggaaactcacctggctcggtagcaaggtttggagatatccggaagtg
agggtggaagaggtaccagaaccaagaatcgaaaaacccacggaaatcataatcaaggtg
aaagcctgtggaatctgtggaagtgatgtccatatggctcaaactgatgaagaaggttac
attctctacccaggtctcaccggttttcctgtcactttgggtcacgagttctcgggagtt
gtggttgaagcgggaccggaagccataaatagaagaacaaacaaaagattcgaaattggg
gaacctgtctgtgcggaagagatgctctggtgtggccattgcagaccgtgtgcggaagga
tttcctaaccactgcgaaaatctcaacgaacttgggttcaatgtggatggagcgtttgcg
gagtatgtaaaagtggacgcaaagtatgcgtggagtctcagagaacttgaaggagtgtac
gaaggtgacagactattcctcgcaggaagtcttgtggagcccacatctgttgcttacaac
gctgtgatcgtaagaggtgggggtatcagaccgggcgacaacgtggtgattctgggagga
ggtcctattgggctcgcggccgttgcgatcctgaaacacgctggtgcttcaaaggtgatt
ctttctgaaccttcggaggttcggagaaatctggcaaaagaactcggagcggatcacgtg
atagaccccaccaaagagaattttgttgaggcggttctcgattacaccaacggccttgga
gcaaaactctttcttgaggctactggagttcctcagctcgtctggcctcagatagaagag
gtgatctggagggctcgcggtatcaatgccacagtggcgatcgtagcgcgggccgatgca
aaaatacctctcaccggtgaggttttccaagtgaggagagctcagattgtgggatctcaa
ggacattcgggacacgggacatttccacgtgtgatcagcctgatggcatccggcatggat
atgacgaagatcatatccaaaacggtttcaatggaggagatacctgaatacataaagaga
cttcagactgacaaatctttggtgaaggttaccatgctgaacgagtga

DBGET integrated database retrieval system