KEGG   Thermaerobacter marianensis: Tmar_0178Help
Entry
Tmar_0178         CDS       T01388                                 

Definition
(GenBank) Manganese/iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tmr  Thermaerobacter marianensis
Brite
Enzymes [BR:tmr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Tmar_0178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N POTRA_TamA_1
Motif
Other DBs
NCBI-ProteinID: ADU50303
UniProt: E6SLN6
LinkDB All DBs
Position
201492..202106
Genome map
AA seq 204 aa AA seqDB search
MAYQLPPLPYDYNALEPHIDEQTMRIHHDRHHATYVNNVNAALEKYPALQNKPIEELLRQ
IDQVPEDIRTAVRNNGGGHANHSLFWEIMSPRGGGQPSGALAEAINRSFGSFDAFKDQFT
KTATTHFGSGWAWLVVDEKGELQVYSLPNQDSPYMKGHTPILGLDVWEHAYYLKYQNKRP
DYIAAWWNVVNWDEVARRYQQARG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtggcttaccagctgccacccctgccgtacgactacaacgccctcgagcctcacatcgac
gagcagaccatgcggatccaccacgaccggcaccacgccacctacgtgaacaacgtcaac
gccgccctcgagaagtaccccgcgctgcagaacaagcccatcgaggagctcctgcgccag
atcgaccaggttcccgaggacatccgcaccgcggtccgcaacaacggcggcggccacgcc
aaccactcgctcttctgggagatcatgagcccgcgcggcggcggccagccctcgggcgcc
ctggccgaggccatcaaccggtccttcggcagcttcgacgccttcaaggaccaattcacc
aagaccgccacgacccacttcggcagcggctgggcgtggctggtggtggacgagaagggc
gagctgcaggtctacagcctgccgaaccaggacagcccgtacatgaagggccacaccccc
atcctgggcctggacgtctgggagcacgcctactacctcaagtaccagaacaagcggccc
gactacatcgccgcctggtggaacgtggtcaactgggacgaggtggcccggcggtaccag
caggcccgtggctga

DBGET integrated database retrieval system