KEGG   Thermaerobacter marianensis: Tmar_0261Help
Entry
Tmar_0261         CDS       T01388                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
tmr  Thermaerobacter marianensis
Pathway
tmr00473  D-Alanine metabolism
tmr01100  Metabolic pathways
tmr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tmr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Tmar_0261
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Tmar_0261
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tmr01011]
    Tmar_0261
Enzymes [BR:tmr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Tmar_0261
Peptidoglycan biosynthesis and degradation proteins [BR:tmr01011]
 Precursor biosynthesis
  Racemase
   Tmar_0261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADU50386
UniProt: E6SM56
LinkDB All DBs
Position
303616..304800
Genome map
AA seq 394 aa AA seqDB search
MEGPGRGRPVRPTWVEVDLDAIAHNVQTLQRLAAPAQLMAVVKADGYGHGAVMVARTALA
HGARRLAVAVVEEGVHLRQSAIACPILVMGWTPPWQYSLALRYDLELAVSSEDEARALAE
AARREGRKVRVHLKVDTGMGRLGLRWDHPRLAETAARIAGLGGLEVVGVFTHLATADDPE
APLTEDQLARFARIVHALDERGLRPLLRHAANSAALLRLPGARYDLVRPGIALYGLEPFP
GAVAAFGLRPALAWKTRVALVKEVPPGTPISYGATFVTRRRSRIATLPVGYADGLRRALS
NRGQVLVGGRRAPIVGRVCMDQVMVDVTDAGPVAVGDEVVLIGRQGDQQITADEMAGWMD
TIGYEVVTGIGRRVPRIYLRGGRPVAQAPVSHLL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
ttggaagggccgggccgggggcggccggtgcgccccacctgggtggaagtcgacctggac
gccatcgcccacaacgtgcaaaccctccagcggctggccgcccccgcccagctcatggcg
gtggtcaaggccgacggctacggccacggcgcggtgatggtcgcccgcacggccctggcc
catggtgcccgccgcctggccgtggcggtggtggaagagggcgtccacctgcgccagtcg
gccatcgcctgtcccatcctggtcatgggctggaccccgccctggcagtacagcctggcg
ctgcgctacgacctggagctggcggtcagcagcgaggacgaggcccgggccctggccgag
gccgcccgccgcgagggccgcaaggtgcgggtgcacctgaaggttgacaccggcatgggc
cgcctgggcctgcgctgggaccatccgcggttggccgagacggcggcccggatcgccggc
ctggggggcctggaggtggtcggggttttcacccacctggccacggccgacgaccctgaa
gcccccctcaccgaggaccagctggcccgcttcgcccggatcgtccacgccctggacgag
cgcggcctgcggcccctcctgcggcacgcggccaacagcgccgccctgctgcggctgccc
ggggcccggtacgacctggtccgccccggcatcgccctctacgggctcgagcccttcccc
ggcgccgtggcggccttcggcctgcggcccgccctggcgtggaagacacgggtcgccctc
gtcaaggaggtccctcccggcacccccatcagttacggggccaccttcgtcacccgccgc
cgctcccgcatcgccaccttgccggtggggtacgccgacggattgcggcgggccctgtcc
aaccgcggacaggtgctggtgggcggccggcgcgcgcccatcgtgggccgggtctgcatg
gaccaggtgatggtcgacgtgaccgacgccgggccggtggccgtgggggacgaggtcgtc
ctcatcggccgccagggcgaccagcagatcaccgccgacgagatggcgggctggatggac
accatcggctacgaggtggtcaccggcatcgggcgccgggtgccccgcatctacttacgg
gggggccgtcccgtggcgcaggcgccggtgtcccacctgctgtga

DBGET integrated database retrieval system