KEGG   Thermaerobacter marianensis: Tmar_1128Help
Entry
Tmar_1128         CDS       T01388                                 

Definition
(GenBank) DNA polymerase LigD, ligase domain protein
Organism
tmr  Thermaerobacter marianensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ADU51241
UniProt: E6SKN3
LinkDB All DBs
Position
complement(1365894..1366928)
Genome map
AA seq 344 aa AA seqDB search
MPGGGPPVPRTWDELWQPGRLQPMLARRAPAPFSSPAYRYEIKWDGYRCLVFADPGAGRT
FLQSRHGYDLTPLFPELAGVHRLLPAAAVLDAEIVALVDGRPSFAALQQRAGGVGRGARI
PAAAPIAPALLVLFDLLGLAGAVWLGRPLAERVRGLKDLFPEGAAPGVAVSRGVEGDGAA
FFRRVRDQGLEGVVAKRLDSPYLPGWRTAHWQKIKAEREVDAVVGGVVPGGRAAGVGTLL
LGLFAPDGALHYVGHVSTGLGGEEARHLLGRLRARPTCPFVTVPARARGQPVVWVEPNLV
CEVAYLEWTPQGHLRHPVFRRWRDDKDARACRLPAEARAGAPGA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgcccggtggaggaccgccggtcccccggacgtgggacgagctctggcagccgggccgg
ttgcagcccatgctggcccgccgcgcgccggcccccttctcgtcccccgcgtaccggtac
gagatcaagtgggacggatatcgctgcctggtgttcgccgaccccggtgccggccgcacc
ttcctccagtcgcgccacggctatgacctgaccccgctcttccccgaactggccggcgtg
caccgtcttctccccgcggccgccgtcctggacgccgagatcgtcgccctggtggatgga
cgcccgtccttcgccgccctccagcagcgggccggcggggtgggccgcggcgcccggatc
ccggcggcggcacccatcgccccggcgctcctggtgctcttcgacctgctgggtctggcg
ggagcggtgtggcttggccggccgctggccgagcgggtgcgggggctgaaggatctcttc
ccggaaggggccgctcccggtgtcgccgtctcccgcggcgtcgagggcgacggcgcggcg
ttcttccggcgcgtccgggaccagggcctggagggcgtggtggccaagcgcctggacagc
ccctatttgccgggatggcgcaccgcccactggcagaagatcaaggcggaacgggaagtg
gatgccgtggtgggcggcgtggtccccggcggccgcgccgcgggggtgggaacgctgctg
ctcggcctctttgcacccgacggggcgctgcactacgtagggcacgtcagcaccggtctc
ggtggggaagaggcccgccacctgctggggcggctccgggcccggcccacctgccccttc
gtcacggtgccggcccgcgcccgcggccagcccgtggtgtgggtcgagcccaacctggtc
tgcgaggtggcctacctggagtggacgccccagggccacctgcggcatcccgtcttccgg
cgctggcgtgacgacaaagacgcccgcgcctgccggttgcctgcggaggcacgggccggc
gcacccggcgcgtga

DBGET integrated database retrieval system