KEGG   Thermaerobacter marianensis: Tmar_1738Help
Entry
Tmar_1738         CDS       T01388                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tmr  Thermaerobacter marianensis
Pathway
tmr00620  Pyruvate metabolism
tmr00680  Methane metabolism
tmr01100  Metabolic pathways
tmr01120  Microbial metabolism in diverse environments
tmr01200  Carbon metabolism
Module
tmr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tmar_1738
  09102 Energy metabolism
   00680 Methane metabolism
    Tmar_1738
Enzymes [BR:tmr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Tmar_1738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 PCP PilJ
Motif
Other DBs
NCBI-ProteinID: ADU51842
UniProt: E6SHW2
LinkDB All DBs
Position
complement(2082304..2085714)
Genome map
AA seq 1136 aa AA seqDB search
MADSTAVYPSGHGAPEHGEPAYRSRSEEDLYPLLKQEVDLLGRALGEAIRRLSGDRLFEL
EEDIRARTKHLRQHPGDEAARKALRAQVGSLSVTEAEGLIRAFSTYFHLVNLAEERHRVR
VNRQRERASTPDHPRPESLLALVGQLKARGLSYDDVVRLLASARLVLTFTAHPTETRRRT
LRHHLLELNRTLDRLERGEAQLPEVLARVTLLWTTRELRPAPPRVEDEVRGGLYYLPTTL
WEAVPRLMDALEQAVAAYYGRRPVLPPPLAFRSWIGGDRDGNPFVTPEVTAWAQGYARAE
IARKYAEGLAALTRDLSVAEERALLPPLPSLQGAAIALLAGGAGVTQPERADAAGERGDG
PAGGPGAGTAAAPDPGPDAEAGGGHPRAARTVNGTPGRFLGEPYRQFVYRLQRAWAARTV
PEEVWGDGAGAGGGATIAVQRPFTVETPATLPGLRHEGEGEGKGRPERPDPLVCPDRAND
ANRPDTPARPPRSGPRDESDSAADPGDLAGLLHQVERGLEAAGLGEAAATLVRPLRWRAQ
VFGEAMAPLDVREHAEAHGRAVAELLEAGGVMPAADYLALDPAAREERLTRELATPRPLA
PVGYVPRTRELAVALGALRAWQGRGAYIISGCRGPADVLEVFVLAREAGLYRPGQPLPFD
VVPLFETLADLEAAPAAMERLLRNPVFGAHARARGGCEVMIGYSDSSKDAGYLAANWALY
RAQEGITAVARAAGIPVSFFHGRGTSTARGGGGTAGRAIASLPPGTVGRRLRLTEQGEAL
ADRYAHPELALRNLEQLLYHFLLAAARDTAVPDQAASDPDERGPAVRPGSPVAPGHAVAG
SDEPSPVAGPGSPAPSALQPASSGETGGRSSVAPEVPPRGSARSESPVRFEDPRRAQEPL
AGGGSAAVPPVWREAMDRAAARSAEAYRQLLAEPGFFEFFEHFTPIREIAALKIASRPVA
RTGRARRVQDLRAIPWVMAWTQVRLLLPGWYGLAEGLAAVPRDLRQEMFARWPFFRSVLD
GAALALAKADLAVAREYLRLVPEPLAGRFFPRLEQAFLRTRELLEETFGGPLLAHHPVLA
RQTALRNPYVDPISYLQVELLARYRSAPPDDPQRPALERALLLSILGIAAGLRNAG
NT seq 3411 nt NT seq  +upstreamnt  +downstreamnt
atggccgattccacggcggtatacccatccggacatggcgcacccgaacatggcgaaccg
gcgtatcgcagccgcagcgaggaagacctctaccccctgttgaagcaagaggtcgacctc
ctcgggcgtgccctgggcgaggcgatccgccgcctctccggcgaccgcctcttcgagctc
gaggaggacatccgcgcccgcaccaagcacctgcgccagcatcccggcgacgaggcggcg
cgcaaggcgctccgagctcaggtgggcagtctctcggtgaccgaggcggaggggttgatc
cgggccttctcgacctacttccacctggtcaacctggcggaagagcggcaccgggtgcgg
gtgaaccggcagcgcgagcgggccagcacgcccgaccacccgcggccggagtcgctgctg
gccctggtcggccagctcaaggcccggggcctgagctacgacgacgtcgtgaggctcctt
gcctcggcccggctggtgctgaccttcaccgcccatcccacggaaacccgccggcgcacc
ctgcgccaccacctgctggagctcaaccggaccctggaccggctggagcgcggggaggcc
cagctgcccgaggtcctggcgcgggtgacgctcctctggaccacccgcgagctgcggccg
gcaccgccccgggtggaggacgaggtccggggcgggctctactacctgcccaccaccctc
tgggaggccgtgccgcggctgatggacgccctcgaacaggcggtggccgcctattatggg
cggcggccggttcttcccccgcccctcgccttccgcagctggatcggcggcgaccgggac
ggcaaccccttcgtgacccccgaggtgacggcctgggcccaggggtacgcccgggcggag
atcgcccgcaagtacgccgagggtctggcggccctcacccgggacctttccgtggcggag
gaacgggcgctgctgccgccgctgccgtcgctgcagggcgcggcgatcgccctgctggcg
gggggcgcgggagtcacgcagcccgagagggcggacgcagcgggcgaacggggggatgga
ccggcgggtggccccggggccgggacggccgccgcaccggacccggggccggatgccgaa
gccggcggcggacacccccgggcggcacggaccgtcaacgggacgccgggccgcttcctc
ggtgagccctatcgccagttcgtctaccggttgcagcgggcgtgggcggcgcgcaccgtg
cccgaggaggtgtggggtgacggggccggtgccggtgggggtgcgaccattgcggtgcag
cgcccctttacggtcgagacaccggccaccctgccgggccttcgtcacgaaggcgagggg
gaggggaaagggcggcctgagcggccggatcctttggtttgtccggaccgtgccaacgac
gcgaaccgtccggacacgccggcccgcccgccccggtcgggcccgcgcgacgaatcggac
tcggcggccgatccgggcgacctggccgggcttctccaccaggtcgaacgcggcctcgag
gccgccgggctcggcgaggcggccgcgaccctggtacggcccttgcgctggcgggcccag
gtgttcggtgaggccatggcgccgctcgacgtgcgggagcacgccgaggcccacgggcgg
gccgtagcggagctcctggaagccggcggcgtcatgccggccgcggactatctcgcgctg
gatcccgcggcgcgggaggaacggctcacccgcgagctggccaccccccgccccctggcg
ccggtgggttacgtgccccggacccgcgagctggccgtggccctgggcgctctgcgagcg
tggcagggccggggtgcctacatcatcagcggttgccgcggccccgccgacgtgctggag
gtcttcgtcctggcgcgggaggcgggcctctaccggcccgggcagcccctgcccttcgac
gtggtccccctcttcgagaccctggcggacctggaggcggctccggcggccatggagcgg
ctgctgcggaaccccgtcttcggcgcccacgcccgggcccgggggggctgcgaggtgatg
atcggctactccgactccagcaaggacgccgggtacctggccgccaactgggccctctac
cgggcgcaggagggcatcacggcggtggcacgggcggcgggaatcccggtgtccttcttc
cacggccgcggcacctccacggcccgtggcgggggaggaaccgccggccgcgctattgcc
agcctgccgccgggcaccgtgggccggcgcctgcggctgaccgagcagggcgaggccctg
gccgaccgctacgcccaccccgagctggccctgcgcaacctggagcaacttttgtaccat
tttctgctggcggcggcccgggacacggccgtgcccgaccaggcggcctctgacccggac
gaacgcggcccggcggtccggcctggcagcccggtggcacccggccacgcggtggccgga
tcggacgaacccagcccggtggccgggcccgggagcccggcgccatctgccctacaaccc
gcaagctcgggcgagaccggggggcgaagctcggtagcgcccgaggtgccgccccgcggc
tcggcacgatccgaaagcccggtgcggtttgaggacccgcgacgggcacaggagcccctt
gccggcggtggatccgccgccgttccccctgtctggcgggaggccatggaccgggccgcg
gcgcggtctgccgaggcgtaccgccagctgctggcagagcccggcttcttcgagttcttc
gagcacttcacgcccatccgggagatcgccgctctgaagatcgcctcccgccccgtggcc
cgcaccggccgcgcccggcgggtccaggacctgcgggccatcccctgggtcatggcctgg
acccaggtgcgcctgctgctgccgggctggtacgggctggccgaggggctggccgcggtc
ccccgcgacctgcgccaggagatgttcgcccgctggcccttcttccgctcggtgctggac
ggcgccgccctggccctggccaaggcggacctggctgtggcccgggagtacctgcggctg
gtgcccgagccgctggcgggccggttcttcccgcgcctggagcaggcgttcctgcgcacc
cgcgagctcttggaggagaccttcggcggcccgctcctggcccatcaccccgtgctggcg
cgccagacggccctgcgcaacccctacgtcgaccccatcagctacctgcaggtcgaactg
ctggcgcggtaccgctcggcgccgccggacgacccccagcggcccgccctggagcgggcg
ctcctgctctccatcctcggcatcgccgccggcctgcggaacgccgggtag

DBGET integrated database retrieval system