KEGG   Tremella mesenterica: TREMEDRAFT_24338Help
Entry
TREMEDRAFT_24338  CDS       T03139                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
tms  Tremella mesenterica
Pathway
tms00052  Galactose metabolism
tms00500  Starch and sucrose metabolism
tms01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    TREMEDRAFT_24338
   00500 Starch and sucrose metabolism
    TREMEDRAFT_24338
Enzymes [BR:tms01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     TREMEDRAFT_24338
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 18491354
NCBI-ProteinID: XP_007000488
JGI: Treme1_24338
LinkDB All DBs
Position
Unknown
AA seq 868 aa AA seqDB search
AYGHDIEELVLLVEYQTADRLHVHIYDAAEQQYQIPTDLFPRPPTFPIDSHLADDHVPSK
LKFHHTPIGELFAFWITRGDDPEPIFDTRPANLPLHLSPMGKDGRVIRDSTISSHSLIYE
DQYLQMSTSLPTNANIYGLGEVVSSSGFRRDPNGTIATMWNRDSGGTPIDENLYGSHPFY
LEVRPTGSHGVFMLNSHGMDVILRPEVLQYRMIGGTFDLYFLAGPTPIQVVEQYSHVVGK
PSKIPFWALAFHLSRWGWKSVKEIEGVMEKMEEKGVPLDVVWSDLDYMDRYRNFTVKQEY
HSRDLLKFTRALHESKRYYVPIVDAGFGISGEGDGYDTYDHGHRKGVFIKNAEGEEFIGE
VWPGKTVFPDWTNPSTTQWWQSSFDNFRQVCEYDGIWLDMNEPASFTDAPIKADPREKLK
SRGRSSSRSVSPDKSVVSSSIPRPSSPCKIRTISPTKERSPSPTKGAQSSNPASPSAEKH
KKSMTQRLEHSLLDLPPYAIHQALKDLGSMTVGPTCLNADGSRHYNTHNLYGYHESVLTS
KVLEKQIPGKRQFILSRSTFAGSGRVAAHWLGDNDSTWRSMRESVQGVLQFQLFQIPMVG
PDICGFHGDATEELCDRWMQLGAFYPFFRNHNHIDAQGQEPYRWPSVAAASRKAILARYS
LLPYWESLFSNASDHGSPIIRPLFFHFPNPKLLDVDAQFMLGPSILVTPVFERGATTVRG
YFPKEGAPWRCLWTQQEVKTDEHDMTTLSAPLGHINVHIRAGTILMVYDKPRQTIRTTRE
KSDFGLIINLDKQGQASGEVILDDGVSLNSQRTTMRFKFINGELSINSEGEYTVPNRIRR
VTLLGSHDKPRDVLVLGDGQEVGRLDRS
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
gcttatggtcatgatatcgaggaactcgtcttactcgtagaatatcaaaccgctgaccgt
ttacacgttcatatatatgatgcagctgagcaacaataccaaatccctaccgatctattt
cctcgtccccctacctttccgatagattcccaccttgccgacgaccacgtcccatccaaa
ctcaaattccaccatacacccatcggagaactcttcgccttctggatcacccgtggtgat
gaccccgaacctatattcgacacccgtcctgctaacctacctcttcacctcagtccaatg
gggaaagacggccgagtcataagagacagtaccatctcctcacattccttaatctatgaa
gatcaataccttcaaatgtccacttcattacctaccaacgccaacatatacggtctcggt
gaagttgtttcttcttctggttttcgacgagaccccaacggaacaatagcgacaatgtgg
aaccgagattcaggcggtacaccaattgacgaaaatctttacggaagtcatccattttat
ctcgaagttcgaccaactggttcacatggagtgttcatgcttaattctcatgggatggac
gttatcttacgtccggaagtgttgcaatatcggatgatcggaggaacttttgatttatat
ttcttagctggacctacacccatacaagtggtcgaacagtattctcatgtggttggaaaa
ccatctaagatacctttttgggctttggcttttcatttatctcgttgggggtggaagtca
gtaaaggaaatagagggcgttatggagaagatggaagagaagggagtgccgttggatgtg
gtttggagtgatttggattatatggatagatataggaatttcactgtgaaacaagagtat
catagcagagacctgctgaaattcacgagagcgctgcatgaatcaaaacgatattacgtt
ccaattgttgatgcaggttttgggatctctggcgaaggagacggatatgatacgtatgat
catggtcatcggaaaggtgtgttcatcaagaacgctgagggagaggagttcatcggcgaa
gtctggcctgggaaaactgtctttcccgactggaccaatccctccacaacacaatggtgg
caaagctctttcgacaatttccgtcaagtatgcgaatacgacggtatctggcttgacatg
aacgaacccgcttcgttcaccgacgctcctatcaaggctgatccaagagagaaactcaag
tctcgtgggagatcgtcttctcgttcggtctcacccgacaagtcagtagtgtcatcctcg
attcctcggccttcttccccatgtaaaataagaaccatctcgccaaccaaagaaagatct
ccatctccaactaaaggtgcacaatcttcaaatcccgcctcaccctcagcagagaaacat
aagaagtcaatgactcagagattggaacatagtttactggatttaccaccttatgccatc
caccaagctttaaaagatttaggctcaatgactgttggacctacctgtcttaacgcagat
ggatcaagacattacaacactcacaatttatacggctatcatgagagcgttttgacctct
aaagtactggagaagcagataccggggaaaagacagttcatcctttctcgcagcaccttt
gcaggatcgggtagagttgctgcgcactggttaggagacaatgatagtacttggagaagt
atgagagagtcggtacagggtgtacttcaatttcaactctttcaaatcccaatggtagga
cctgacatctgtgggtttcatggtgatgccactgaagagctttgtgatcgatggatgcaa
ttaggagcgttttaccctttctttaggaatcacaatcatattgatgcacaaggacaagaa
ccttatcgctggccttccgtcgctgcagcttctcggaaagccatcttggcgcgatacagt
ctcttaccttattgggaatcactcttctctaacgcgagtgaccatggcagcccaatcatc
cgaccattattcttccatttccctaatccgaaactcctcgacgtggacgcgcagttcatg
ctgggtccttcgatcctcgtcacgccggtgttcgaaagaggcgccaccaccgttcgtggg
tattttccaaaagaaggggcaccttggagatgtttgtggactcagcaagaagtcaaaacg
gacgaacatgatatgaccaccctatcggctcctttaggtcatataaacgttcatatcaga
gcaggaaccatcctcatggtatatgataaaccccgacaaaccatcaggaccactcgagag
aaaagtgattttgggttaattatcaatcttgataaacaaggtcaagcgagtggagaggtg
attttggatgatggtgtctctttgaactcacaacggacaactatgcgattcaaattcatc
aatggtgaattgagtatcaacagtgaaggtgaatatacagtgcccaacagaatcagacgt
gtcactctcttaggtagtcatgataaacctagagatgtgttggttttgggagatggacaa
gaagtagggaggttggaccgatcatga

DBGET integrated database retrieval system