KEGG   Tremella mesenterica: TREMEDRAFT_25563Help
Entry
TREMEDRAFT_25563  CDS       T03139                                 

Definition
(RefSeq) hypothetical protein
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
tms  Tremella mesenterica
Pathway
tms00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:tms00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    TREMEDRAFT_25563
Enzymes [BR:tms01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     TREMEDRAFT_25563
Chromosome and associated proteins [BR:tms03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     TREMEDRAFT_25563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET SRI
Motif
Other DBs
NCBI-GeneID: 18491510
NCBI-ProteinID: XP_007000644
JGI: Treme1_25563
LinkDB All DBs
Position
Unknown
AA seq 869 aa AA seqDB search
MNLKSEPVSGNTEEIKPSLSSSTINGNHDDKLDPSEIKIDHDEQDIKDDLVLLNGNDEKD
KDKDIKRKGEIRKDFKVKGEGKSHTRGNGRKNNGKKNLNVSQNKPVLIDQLPLAWEQACE
SFESLEKCVYERKDLGLSREQDEMMVCDCVYDRDDPHAEPCGSQSDCINRAIFIECLPGE
CRAREQCQNQRFGKRQYAPIDVVLTEMKGFGLRAADDIPEGSLIYEYIGEVIKETTFRKR
MAQYADEGIKHFYFMMLQKEEYIDATKKGGIGRFANHSCNPNSEVQKWVVGRRLRMGIFA
KRDIIKDEEITFNYNVDRYGHDAQPCYCGEPNCVGTIGGKTQTDIGGMSNLFLDALGITD
EVEELEMKGSKKKKSRQLDEDFVPVLHPIQPHEVQKVAAAMRQSMENVRMMSRLLERIKM
TEDPVCQRGLMRLHGFSLMSMILTKLADQQQIILLALESMSKWPLQYKNKVEDSKIEIPV
RALADDQNEVIASTAKQLLTYWDSLAHSFKIPRVPKISSLDAEDEAATTTIAEFDSLHSH
SQSSHRTNTWENTGQIQFDVAPVRSRPNIPFVRPKPPLPPPKPAPTQSTIADRSKLDAII
ALAQQTMAAAVAAQNVVTESPAESSRSGSRSRLDDTPGDDEDRKKRAKRMYEMDEARKEK
RLKVVVGEWVVKSMSKYKSQMDHDTFKKYAKECTLILVEKEKKSPSYATTSHPNLTEEKK
TKMKSFVKEYTHKLLKKLKDKGKLKSSHSRSSHSHSQSHSQSHSQSHSHSHSHSHSHSHS
TRSEIPAEPTERPPDPPGEIDEGVMEDVADMFSDDEMDIDLDDDDEDEDETRDEVSKKRK
IMGNGLSGLVDTPERTPLSDPSPHGNGMR
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcaaatcagaacctgtctcgggcaatacagaagaaatcaaaccctccctttca
tcctctacgatcaatggtaatcatgatgacaaactcgatccatcggaaataaagatcgac
catgacgagcaagatatcaaagatgatcttgtccttctcaatgggaatgatgagaaagat
aaagataaagatatcaaaagaaaaggagaaataaggaaagatttcaaagtgaaaggagaa
gggaaaagtcacacgagaggaaatggtaggaaaaataatggaaagaaaaacttgaacgtt
tctcagaacaaacctgttttgattgatcaattacctttagcatgggaacaagcttgtgaa
agttttgaaagtttagagaaatgtgtttatgagagaaaagatttaggtttgagtagggaa
caagatgagatgatggtttgtgattgtgtttatgaccgagatgaccctcatgcagaacct
tgtggatctcagtcggattgtataaacagagctatctttatcgaatgtttacctggggaa
tgtagagcaagggaacaatgtcaaaatcaacggttcggaaaacgacaatatgcacctata
gatgttgtgttgaccgagatgaaagggtttggtttgagagcggcggatgatataccagag
ggttcgttgatctacgaatacattggagaagtgattaaagagactacctttagaaaacga
atggctcagtatgcagatgaaggtatcaaacatttttactttatgatgttgcagaaggag
gagtacatcgacgcgacgaaaaaaggtgggataggacgattcgcaaatcactcttgtaac
cctaattccgaagttcagaaatgggtcgtaggtcggagattacgcatgggtatctttgcg
aagagggacattatcaaggatgaggagatcacttttaactataatgtggatcggtatggt
cacgacgctcaaccatgttactgcggcgaaccaaattgcgttggcacgatcggcggaaag
acgcaaacagatataggaggaatgagcaacctcttccttgatgctctgggtatcacggat
gaagtggaagagttggagatgaaaggtagcaagaagaagaaatctcgtcaattggatgaa
gactttgttcctgtgttacatcccatacaaccacacgaggttcaaaaggtcgctgctgcg
atgcgacaatctatggagaatgtcagaatgatgagtcggttgttggaacgaataaaaatg
acagaggatcctgtttgtcaaagagggttgatgcgacttcacgggttttcactcatgagt
atgattttgaccaaactagcagaccaacaacagattatccttcttgcactggaaagcatg
tcaaagtggcctttacagtataagaacaaagtggaggattcaaagattgaaattcccgtt
cgagcattggcagatgatcaaaatgaagtcattgcatcgacagccaaacagttgttgaca
tattgggatagtttagctcattcattcaagattcccagagtaccgaaaatatcttctctc
gacgcggaagatgaagcagccaccactacaatagccgaattcgattcattacattctcat
tctcaatcttcacatcgtaccaatacatgggaaaataccggtcaaattcaattcgatgta
gcacccgttcgttctcgacccaatatccctttcgtcagacctaaacctccccttccacct
cctaaacccgcaccgacacaatcaacaattgccgataggtcaaaattagatgctatcatc
gcattagctcaacaaaccatggcagccgctgtggcagctcagaatgtggttactgaaagt
ccggcggaaagcagtagatcaggatctagaagtcgattagatgatacacctggtgatgat
gaagataggaaaaaaagagcaaagaggatgtatgaaatggatgaagcaagaaaagaaaag
agattaaaggttgtagttggtgaatgggtcgtgaaaagtatgagcaaatataaatctcaa
atggatcatgatacttttaaaaagtatgccaaggagtgtacactcatattggttgaaaaa
gaaaagaaatctccttcctacgcaaccacctcacatcctaatctgacagaagagaaaaaa
acaaagatgaaatcttttgttaaagaatatacacataaacttctcaaaaagcttaaagat
aaaggaaaactcaaatcttcacattctcgttcatcccattctcattctcaatcacattct
caatcacattctcaatctcattcacattcacattcccattcacattcacattcacattca
acaagatcggagatacctgccgaaccaacggaaagaccacctgatccgcctggtgagata
gacgaaggggtgatggaagatgtggctgatatgttttctgatgatgagatggatatcgat
cttgatgatgatgatgaggatgaggatgagactcgagatgaggtaagtaagaagagaaag
ataatggggaatggattgagtggattggtggatactccagaacgaactcctttgagtgat
ccttctcctcatgggaacggtatgagatga

DBGET integrated database retrieval system