KEGG   Tremella mesenterica: TREMEDRAFT_31295Help
Entry
TREMEDRAFT_31295  CDS       T03139                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
tms  Tremella mesenterica
Pathway
tms03030  DNA replication
tms03410  Base excision repair
tms03420  Nucleotide excision repair
tms03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:tms00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    TREMEDRAFT_31295
   03410 Base excision repair
    TREMEDRAFT_31295
   03420 Nucleotide excision repair
    TREMEDRAFT_31295
   03430 Mismatch repair
    TREMEDRAFT_31295
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tms03032]
    TREMEDRAFT_31295
   03400 DNA repair and recombination proteins [BR:tms03400]
    TREMEDRAFT_31295
Enzymes [BR:tms01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TREMEDRAFT_31295
    6.5.1.6  DNA ligase (ATP or NAD+)
     TREMEDRAFT_31295
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     TREMEDRAFT_31295
DNA replication proteins [BR:tms03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    TREMEDRAFT_31295
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     TREMEDRAFT_31295
DNA repair and recombination proteins [BR:tms03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     TREMEDRAFT_31295
   NER (nucleotide excision repair)
    Other NER factors
     TREMEDRAFT_31295
   MMR (mismatch excision repair)
    Other MMR factors
     TREMEDRAFT_31295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C HHH_6
Motif
Other DBs
NCBI-GeneID: 18492209
NCBI-ProteinID: XP_007004925
JGI: Treme1_31295
LinkDB All DBs
Position
Unknown
AA seq 824 aa AA seqDB search
MGKPIGATTHKTGKITSAAVEPVEPIDFDVDQFLFRPEEVNVSNWPKGRLPYSVLVGVYV
QVSSTRSRLLIVRVLTNFLHLVLHASPIDLPPSLYLLSNHLLPSYLPCELGIGSQILSKA
IQEVSGLQPRDLKKLWEKWGDPGDVAFEAKSNLRTLVQPAPLLVEDVYNRLLGMSRIKGA
QSARLKGDIVRKLMVQARGEEARFLVRSLVGNLRIGAVRLTLLTSLARATALLHMDKELL
GQVKEIPPLATKEKGKRAVKVKVEPEPAREEVEQKCLEAVKLVRKVYVRHPNYRDLVIGL
ENGGLIGLEDRVAVNVGIPLSPMLGSITRSLNEVFTRLGTLPFTAEAKLDGQRVQIHARF
DGPQGEPDGGGRWVEAEDGSRIWVRLFSRHLEDMTEKYPDVLHLVLTLLTRSLPSRTTFP
KEASEPSQDVLALLQTKQIRSFVMDAEIVAVDKESGAFRTFQDLSNRAKKDVKVEDIKVV
VGVFAFDLMLLDDVPLLDAPFSHRRHLLRTLFPSFKNPSDPTLARFEHVESIDSNSLTDV
PAELQTFFERVVEQKCEGVMVKLLESGEGITGEDAEDDDVVGEGKENTPSKKGKKGGGNK
KPLPATYEPDQRSQGWLKVKKDYLEGLGDSLDLVPIGAWWGQGRKAGWWSPILLACHNPQ
TGALEAVCKCDIGISGFTDQFYKDLLIRYPPEGQPEKCSKSSPLGYYDTGGLRPDVWFAP
SEVWEIRGADITLSPVYPAGASLLGGERGLSVRFPRFIRVRDDKGWEQASTSEQFADMYR
RQMREVPSRVVESSGAQIRVESDDEDEIKVGDDDGDDDVGMGDG
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atggggaaacctataggtgctactacccacaagaccggaaagatcacatcggccgctgtg
gaacctgtcgagcctattgattttgacgtggatcaatttctctttcgaccagaggaggtg
aatgtgtcgaattggccaaaggggaggttaccgtatagcgttttggtcggagtatacgta
caggtctccagcacacgcagtagacttctcatcgtcagagttcttaccaactttttacac
cttgtacttcatgcctctccgatcgacctcccaccatcactctaccttctctcaaaccac
cttctcccctcttacctcccttgcgaactcggcatcggttctcagatattgtcaaaagcc
atacaagaagtatccggtctccaacctcgagatctcaagaaactatgggaaaagtggggc
gaccccggagatgtggcttttgaggcaaaatcaaatcttcgcactttagtccaaccggct
cctcttctggtcgaagacgtatacaatcgtctcttaggaatgtctcgtatcaaaggcgct
cagagtgctcgactaaaaggagatattgtacggaaactcatggtgcaagctcgtggagaa
gaagcgcgattcttagtgcggagtttagtgggaaatctcaggataggagctgtacgtttg
acacttcttaccagtctggctagagctaccgctttattgcatatggataaggaattgcta
ggacaagtgaaggagatccctcctctcgcaacgaaggagaagggaaaacgagcggtcaaa
gtaaaggtagaacctgagccagctagggaagaagtggaacagaagtgtttggaagctgtg
aagttggtaagaaaggtatatgtgcgtcatccgaactatcgagatctagtgattggattg
gagaatggagggttgatcggcctagaggacagggtcgcggtcaacgtcggtatcccatta
tctcccatgcttggttcaataactcgctccctcaacgaggtattcacccgtctcgggacc
ctccccttcaccgcagaagccaagcttgacggacaaagagtccaaatacacgctagattc
gatggaccccaaggtgagcctgacggtggtgggagatgggttgaagcagaggatggatct
agaatctgggttcgactgttctcgcgacatttggaagatatgacggagaagtatcccgac
gttttacatctggtgctcaccctcctcactcgatcacttccttctcgaaccaccttcccc
aaagaagcatcagaaccaagtcaagatgtgttggcgttgctacagacgaagcagataagg
agttttgtcatggatgctgagatcgtggctgtggacaaggaatctggagcgttcaggacc
tttcaggatttgtcgaatagagcgaaaaaggatgtgaaggtggaagatatcaaggtggtt
gttggggtctttgcttttgatttgatgttgctcgacgatgtgcctttgctagacgctccc
ttttcacatcgtcgacatctcctccgtaccctgttcccatcattcaaaaacccttccgat
cccacattggcgcgattcgaacatgtcgaatctatcgactccaactctctaacggacgta
ccggccgaacttcaaactttcttcgaacgcgtcgtggagcaaaagtgcgaaggcgtcatg
gtgaaactcctcgagtctggggaaggtataacaggagaggatgcagaggatgatgatgtc
gtaggagaagggaaagaaaatactccaagcaaaaaggggaagaaaggaggtggaaacaag
aaacctttacctgcgacgtatgaacctgatcagagaagtcaaggatggttaaaggttaag
aaagattatttggaaggtttaggtgattcgttagatttagtacctattggtgcgtggtgg
ggacaagggagaaaagcaggatggtggtctcctattttattggcttgtcataatccccaa
acgggagctttggaagcagtgtgtaaatgtgacataggtatttccggtttcaccgatcaa
ttttataaagatcttctcatccgttatcctccagaaggtcaacctgaaaaatgtagtaaa
tcttcccctttaggatattacgacactggtggtcttcgtccagacgtttggttcgctcct
agtgaagtatgggagattagaggggcggatataacactttctcctgtttatcccgctggg
gccagtttactcggtggggaaagaggtttaagtgtgagatttcctaggttcatacgtgtt
agagatgataaaggttgggaacaagcttctacttctgaacagttcgcagatatgtatagg
agacaaatgagagaagtaccgagtagggttgtagagtcttcgggagcgcagataagggtt
gaatcggatgatgaggatgagataaaggttggagatgatgatggtgatgatgatgtcggg
atgggtgatgggtga

DBGET integrated database retrieval system