KEGG   Tremella mesenterica: TREMEDRAFT_31309Help
Entry
TREMEDRAFT_31309  CDS       T03139                                 

Definition
(RefSeq) hypothetical protein
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
tms  Tremella mesenterica
Brite
KEGG Orthology (KO) [BR:tms00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tms01001]
    TREMEDRAFT_31309
Enzymes [BR:tms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     TREMEDRAFT_31309
Protein kinases [BR:tms01001]
 Serine/threonine kinases: Other
  CAMKK family
   TREMEDRAFT_31309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Pkinase_fungal Kdo YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 18492210
NCBI-ProteinID: XP_007004926
JGI: Treme1_31309
LinkDB All DBs
Position
Unknown
AA seq 297 aa AA seqDB search
MDVGRTARDLDLEGQEGRSAPWGGTRTVDEDPLGLIRREIAIMKKLDHPHIVLLYEAISV
PSTDSLFLVLEYLPGGVLMHIHAGAPDDKAKSPFALEQAKEYFRQLCLGLEYLHENGVIH
RDIKPDNILLTADHESVKLCDFGVSEMFVSRGDDRIKKSGGSPAFLSPESFNSSIHDLHG
KAVDIWALGVVLYCMITGRLPFNVVNPIELFEVVRSKDPPIPLDWTKELKDLMMSMLDKN
PETRIAMKDIREHPWTTSKGDEPMIPTDENLFDVGKHVEEPTAEELGNAFCALRSVL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgggtagaacagctagagatttggatttggaaggacaggaaggtaggagtgct
ccttggggagggaccagaacggtggatgaagatcctctgggtttgataagaagggagatc
gccatcatgaagaagttggatcaccctcatatcgtcctactctacgaggccatctccgtc
cctagtaccgattctctctttctcgtcttggaatatcttccaggaggagtgctaatgcac
attcacgctggtgcaccggacgacaaggcgaaatcgcctttcgcgctggaacaggctaaa
gagtattttcgtcaattgtgtctcggtctggaatacttgcatgaaaacggggtgattcat
cgtgatatcaaaccggacaatattctcctaactgccgaccatgaatccgtcaagttgtgt
gactttggcgtgtcagagatgttcgtgtcgaggggtgacgaccgtatcaagaaatcaggt
ggtagtcctgcttttctctctcccgagagtttcaactcttccatacatgaccttcatgga
aaagcagtagatatctgggcactaggcgtagtgctctattgtatgatcacgggcagacta
ccgttcaacgttgtcaaccctatagaattgttcgaagtggtcagaagtaaagatcctccg
atccctttggattggacgaaagaattgaaggatttgatgatgagcatgttggataagaat
cccgaaactcggattgctatgaaggatatacgagaacacccatggaccacaagcaaagga
gacgaaccgatgatacctaccgacgaaaatctgtttgatgttggtaaacatgtggaggag
cccacggcagaggagctgggcaatgcattttgtgctttgcgaagtgttttgtga

DBGET integrated database retrieval system