KEGG   Tremella mesenterica: TREMEDRAFT_36755Help
Entry
TREMEDRAFT_36755  CDS       T03139                                 

Definition
(RefSeq) hypothetical protein
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
tms  Tremella mesenterica
Pathway
tms00290  Valine, leucine and isoleucine biosynthesis
tms00770  Pantothenate and CoA biosynthesis
tms01100  Metabolic pathways
tms01110  Biosynthesis of secondary metabolites
tms01130  Biosynthesis of antibiotics
tms01210  2-Oxocarboxylic acid metabolism
tms01230  Biosynthesis of amino acids
Module
tms_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
tms_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:tms00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    TREMEDRAFT_36755
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    TREMEDRAFT_36755
Enzymes [BR:tms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     TREMEDRAFT_36755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-GeneID: 18492815
NCBI-ProteinID: XP_007000842
JGI: Treme1_36755
LinkDB All DBs
Position
Unknown
AA seq 639 aa AA seqDB search
MSAPCEGCTCGRAQGNVLSPLEQEEQFHERPERSFTSPLDWVEPTEGIEPAVPLRSKKWF
NSPEDDMCAGYVERFLNGGLTMGEITAKKKPIIGIAQTGSDLAPCNSHHVQLAKRVRDGI
LAAGGTPFEFPCHPIQETAKRPTAALDRNLAYLSLVEVLFGYPLDGVVLLTGCDKTTPAL
LMAAATVNIPAICMNVGPMLNGYAGSRLVGSGGVVWDSRLLLSAGKITEAQYMQRVSLSA
PSVGHCNTMGTASTMNAMAEALGMALPGSASIPAVYRERGACAYQTGRRAVELVMEDVKP
SDILTKAAFENAIAACTAIGGSTNAPIHLNAIAKHIGVDLTCDDWERVGYHLPLLLNIQP
AGKYLCEEYHRAGGLPAIMAELIQAGKLPHPDAMTVSGQTMGDNCRGDLTNDSRVILPFD
KPLMEEAGFLNLKGTLFDSAIMKTSVISPAFREQYLSKPDDPMAFEGPVAVFDGPEEYHH
DIETRKDIKAGTILIMRGTGPKGYPGSAEVVNMIPPGELIKQGVELPCIGDGRQSGTSGS
PSILNASPEAATGGMLGYLKDGDIIRIDLNKRTADVKLTPEEITARKAELGPYKIPTNQT
PWQEIFRNLVGELSEGMVFDMATKYQRVAQVHGVGRRNH
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctccgtgcgaaggatgtacttgcggtcgagcgcaaggaaatgtcttgtcaccg
ttggaacaagaagaacaatttcatgaacgtccagaaagaagtttcaccagtcctctggat
tgggttgagccgaccgagggtatagaacctgctgtacctctcagatccaagaaatggttc
aattctcctgaagatgatatgtgtgcaggctatgttgaacgattcttgaacggaggtctg
acaatgggagaaatcactgccaagaagaagcctatcattggtatcgctcaaactggatcg
gatctcgcaccgtgtaattcacaccatgtccaattggccaaacgagtcagggacggtatt
ctcgctgctggtggaacaccattcgagttcccttgtcatcctattcaagagactgcaaag
cgtcctacagccgcactggatcgtaatctggcctacttgagtttagtcgaggtgttgttc
ggttacccactcgacggcgtagtgcttctcacggggtgtgacaagacaacccctgctctt
cttatggcagctgcgacggtcaacattcctgctatctgtatgaacgttggtcctatgctc
aacggatacgcaggaagtcgattggtcggttctggaggtgtggtctgggacagtcgtctt
cttctttcagctggtaaaatcaccgaagctcaatatatgcaacgtgtttccctttctgca
ccatcagtgggtcattgcaatactatgggcacagcatcaactatgaacgctatggcagaa
gcgctcggtatggctcttcctggatcagcttccatccctgctgtctaccgtgaacgtggt
gcttgcgcctatcaaaccggacgtagggctgtcgaattggtcatggaagatgtcaaacct
tctgatatccttactaaagccgctttcgaaaacgctatcgccgcgtgtacggcaattggt
ggatcgacaaatgctcctatccacttgaacgctatcgctaaacatatcggtgtggatttg
acttgcgatgattgggaacgtgtgggatatcatcttccattattgcttaatatccaacct
gctggaaaatatctttgtgaagaatatcatcgtgctggtggattacctgctatcatggcg
gaacttatccaagctggaaaactcccacatccagacgctatgacagtctcaggtcaaacc
atgggagataattgtcgtggtgatctcacaaacgactccagagtcatattacccttcgat
aaacctctcatggaagaagctggtttcctcaacctcaaaggtactcttttcgattcggca
attatgaaaacttccgttatctcacctgcgttcagagaacaatatttgagtaaacctgat
gatcctatggctttcgaaggtcccgtagcggtattcgatggtcccgaggaatatcatcat
gatatcgaaactaggaaagatataaaagctggaactattttgataatgagaggtacggga
ccgaaaggatatcctggttctgcagaagtggttaatatgattcctcctggtgaattgatc
aaacaaggtgtagagttgccatgtatcggagacggtcgtcaatccggtacttccggttcc
ccgtcaatcctcaacgcttcccctgaagctgcaactggtggaatgttaggataccttaaa
gatggtgatataatccgtatcgacttgaacaaacgtaccgccgatgtaaaactcactcct
gaagaaatcaccgctcgtaaagctgaattgggtccttataagattccgacaaaccaaaca
ccttggcaagagatcttccgtaatctcgttggggaattgagcgagggaatggtgtttgat
atggctacaaagtatcaacgtgtggcacaggttcatggagttggaaggaggaatcattga

DBGET integrated database retrieval system