KEGG   Tremella mesenterica: TREMEDRAFT_37964Help
Entry
TREMEDRAFT_37964  CDS       T03139                                 

Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
tms  Tremella mesenterica
Pathway
tms00500  Starch and sucrose metabolism
tms01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TREMEDRAFT_37964
Enzymes [BR:tms01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     TREMEDRAFT_37964
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 18492918
NCBI-ProteinID: XP_007002504
JGI: Treme1_37964
LinkDB All DBs
Position
Unknown
AA seq 540 aa AA seqDB search
MLFALLTALICVALSRPDRLGLVRAYVQDAGLDSWIQSERTIARQRIGRNIGPILGAGEG
LIVASPSWGQYQDEPDYYYTWTRDAALTISTLLADFLPTPYLTPWNFAPQKYNMSEGDVR
LEPLLREYVNGQASLQVVQNPSGNLFTGGLSEPKFHVDGTAFTGAWGRPQRRDGPALRAL
ALIPYAHYLLDRAWPTDITYVLKHLWDPHSLREQGSVIKNDLEEVGGSWSKSGFDLWEEL
NGYHLFTLLVSYRALQAGSILARRLNDTGAADYYISQSKTLATYLPDFLTPEYWTANLPS
NHIFTNKSTTGTPAKSPEKRSLEVKSRGYFPLRRDRTGLDCAFLLSLIHAGGDILPVSAP
ESLETVWKYVKSFEGIYQINQGSWTNGWAVGRYAEDVYNGVGIGQGNPWFICTFSTAQVL
YSAQSDFHSQGSIQVSNTTVDVWADILGVPSATLNHTAIWKAGSSDGMFDRATKALIAVG
DAYMDVGKKYAVGGRMKEEIDRHDGHEVGARDLTWSYASFLSAARARDLARSIITNPSKR
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgttattcgctcttctcactgctctcatctgtgtcgcactctctcgacctgatcgactt
ggactggtcagagcttatgttcaagatgctggtctggacagttggatacaatcagaaagg
accatagcgagacaacgtataggaaggaatataggaccgatcttaggtgcaggagaaggt
ttgatagttgcttctcctagttggggacaatatcaagatgaacccgattattattacact
tggacaagagatgccgccttgaccatctcaacccttctcgcagacttcctacctactcca
tatttgacaccgtggaacttcgcaccacaaaagtataacatgagcgaaggagacgtacgt
ctagaaccgcttttgagagagtacgtcaatggccaagcttctttgcaagtggtccaaaat
ccttctggcaatctgttcactgggggactaagcgaacccaagttccatgtcgatgggacg
gcattcaccggggcttggggaagaccacagagaagggacggcccagcacttagagccttg
gcgttgataccttatgctcactatcttctcgatcgtgcatggcccacggatatcacttac
gtgctcaaacatctatgggaccctcacagcttacgtgaacaaggtagtgtaattaagaat
gatttggaggaggtagggggaagttggtcgaaatctggttttgacctatgggaagaatta
aacggatatcacctcttcactcttctcgtctcttaccgtgctttacaagcaggaagtatt
ctcgcacgtcgattgaacgacaccggtgctgcagattactacatttctcaatcgaaaact
cttgcaacttatctcccagactttctcactcctgaatactggactgcaaatcttccatcc
aatcacatattcaccaacaagtccaccaccggtactccagctaaatccccggagaaaagg
tctctcgaggtaaaatctagaggttatttccctttgagacgagatcggactggactggat
tgcgctttcttactttctctcattcatgctggaggggatatcttacctgtctctgcccct
gaatcgttggaaacggtatggaagtatgtaaaatcgtttgaaggtatttatcagatcaat
caggggtcatggacgaacggttgggctgtggggagatatgcggaggatgtgtataatggt
gtgggtataggacaggggaatccatggttcatctgtaccttctctaccgctcaagtcctc
tactcggcccaatcagacttccattcccaaggttcgatccaagtttccaacaccaccgta
gatgtatgggcggacattttgggtgtaccatccgcaaccctcaaccatacagcaatatgg
aaagcagggtcgtctgacggaatgtttgaccgtgccacaaaagctttgattgcggtaggg
gatgcttatatggatgtagggaagaagtacgcggtagggggaaggatgaaagaggagatt
gatcgacacgatggtcatgaagtcggagcgagagatttaacttggtcatacgcttctttc
ctctctgccgcacgggctagagatcttgctcggtcaattattaccaacccgtcgaaacgt
tga

DBGET integrated database retrieval system