KEGG   Tremella mesenterica: TREMEDRAFT_38067Help
Entry
TREMEDRAFT_38067  CDS       T03139                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tms  Tremella mesenterica
Pathway
tms00020  Citrate cycle (TCA cycle)
tms00190  Oxidative phosphorylation
tms01100  Metabolic pathways
tms01110  Biosynthesis of secondary metabolites
tms01130  Biosynthesis of antibiotics
tms01200  Carbon metabolism
Module
tms_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tms_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tms_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:tms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TREMEDRAFT_38067
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TREMEDRAFT_38067
Enzymes [BR:tms01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TREMEDRAFT_38067
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 Nucleoporin_FG2 Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 18492926
NCBI-ProteinID: XP_007002512
JGI: Treme1_38067
LinkDB All DBs
Position
Unknown
AA seq 638 aa AA seqDB search
MLRLTKSLGLRTSTRSRNLTRGYVVASQTHRAQEATDFGQKKGYPIIDHEFDAVVVGAGG
AGLRAAFGLAEGGLKTACITKLFPTRSHTVAAQGGVNAALGNMTEDDWRWHMYDTVKGSD
WLGDQDAIHYMCREAPSTVIELEHFGVPFSRTKEGKIYQRAFGGQSLNFGKGGQAYRCAA
AADRTGHAILHTLYGQSLRHNTNFFIEYFAIDLLMQDGECVGVLALNMEDGTLHRFRSHK
TVLATGGYGRAYFSCTSAHTCSGDGNAMVVRAGLPLQDLEFVQFHPTGIYGAGCLITEGS
RGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPDKDHIYLQLSHL
PPEVLHERLPGISETAAIFSGVDVTKEPIPVLPTVHYNMGGIPTKYTGEVLTVDEKGKDK
VVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACANHIKETLEPGKPHKPMQGDLGK
KSIDELDNIRTSSGPLSTAKIRLDMQKTMQTDAAVFRTQESLDEGVKKMSDVYKSYDQVG
IKDRSMIWNSDLIETLELRNIMQCAMQTVVSAAARKESRGAHAREDFPERDDEHWMKHTL
SFQHDPTSPKVDLQYRSVIATTLDENECKPVPPFKRTY
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgctcaggttgaccaaatctctcggtctgagaacatccacgaggagtaggaatcttact
agagggtatgtcgtcgctagtcagacacatagggctcaagaggctactgatttcggtcag
aagaaagggtatcccattattgaccatgagttcgacgctgttgttgtaggagcaggaggt
gctggtcttcgagcggctttcggtctggccgagggaggtttaaaaactgcatgtattacg
aagcttttccctactaggagtcataccgtcgctgcgcaaggaggagtcaatgctgcttta
ggcaatatgacagaggatgattggcgatggcacatgtacgacactgttaaagggtccgat
tggttaggggatcaagatgctatacattacatgtgtagagaggcccccagtacagtcatc
gaactcgaacactttggtgtacctttttctcgaaccaaagaaggtaaaatctatcaaaga
gccttcggcggacaatctttaaatttcggcaaaggcggccaagcttatcgttgcgctgca
gcggccgatcgaaccggtcatgctatccttcacacactttacggtcaatcacttcgacac
aacactaatttcttcattgaatatttcgctatcgaccttttgatgcaagatggtgaatgt
gtcggtgtactcgctctcaacatggaagatgggacccttcataggttcagatctcacaag
actgttctcgctactggaggttatggacgagcgtatttcagttgcaccagtgcacacact
tgttcaggagatggtaacgctatggttgtgagagctggattaccattgcaagatttggaa
tttgtgcaatttcatcctactggaatttacggtgcgggctgtttgatcacggagggatca
cgaggtgaaggcggttacctactcaactctgaaggagagcgattcatggaacgttacgcg
cccaccgcaaaagatcttgcgtctcgtgatgtcgtctctcgatccatgaccctagaaatc
agagaaggacgtggggttggtcctgataaggatcacatttatcttcagcttagtcatttg
ccacctgaagtactccacgaacgtctgcctggtatttcagaaacggctgctatcttctcg
ggtgtagacgtcaccaaagagcccatcccggtgctacctaccgttcactacaacatgggc
ggtatacctaccaaatataccggagaggtcctcactgtcgacgaaaagggtaaagacaag
gttgtccctggattatacgccgcaggagaagccgcttgcgtctctgttcacggtgccaat
cgtctaggcgccaactctctccttgatatcgtagtcttcggtcgagcatgtgccaatcac
atcaaagaaacccttgagcctggtaaacctcacaagcctatgcaaggtgatttgggcaag
aagagtatagatgaattggacaacatccggacttcgagcggaccgttatcgactgcgaag
attagattggatatgcagaagactatgcagacggatgcggccgtgttcagaactcaagag
tccctcgatgaaggtgtgaaaaagatgagcgacgtgtacaagtcgtatgatcaagtcgga
atcaaagaccgtagcatgatctggaacagtgatctgatcgaaacgcttgaactgaggaac
atcatgcaatgcgccatgcaaactgtagtgtctgccgcggcgcgaaaagagtctcgtggt
gctcatgcaagagaagacttcccggaacgagacgatgaacattggatgaaacatacttta
tcgtttcaacacgatccaacttcacctaaagtcgatttacaataccgaagtgtgatcgct
actacgttggacgagaatgagtgcaaacctgtaccacctttcaagcgtacttattag

DBGET integrated database retrieval system