KEGG   Tremella mesenterica: TREMEDRAFT_39456Help
Entry
TREMEDRAFT_39456  CDS       T03139                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
tms  Tremella mesenterica
Pathway
tms00010  Glycolysis / Gluconeogenesis
tms00051  Fructose and mannose metabolism
tms00052  Galactose metabolism
tms00500  Starch and sucrose metabolism
tms00520  Amino sugar and nucleotide sugar metabolism
tms01100  Metabolic pathways
tms01110  Biosynthesis of secondary metabolites
tms01130  Biosynthesis of antibiotics
tms01200  Carbon metabolism
Module
tms_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tms_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TREMEDRAFT_39456
   00051 Fructose and mannose metabolism
    TREMEDRAFT_39456
   00052 Galactose metabolism
    TREMEDRAFT_39456
   00500 Starch and sucrose metabolism
    TREMEDRAFT_39456
   00520 Amino sugar and nucleotide sugar metabolism
    TREMEDRAFT_39456
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    TREMEDRAFT_39456
Enzymes [BR:tms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     TREMEDRAFT_39456
Membrane trafficking [BR:tms04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    TREMEDRAFT_39456
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 18493050
NCBI-ProteinID: XP_007004985
JGI: Treme1_39456
LinkDB All DBs
Position
Unknown
AA seq 537 aa AA seqDB search
MSRNSSSNSLAGVQDNGTNLGSLAGRRASQTIFSMERRTSQGGPRSRRGSGAVLTPSGTT
VVYHTRTNADVEFPHIEKKTIADQLRKYESILTLSPQRMRMIVHAIEESLDKGLQKDGQI
LIHPVPTFVFGWPSGEEMGEYLALDLGGTNLRVCLVTLQGLGKFEVTQTKYRLTEEQKQE
DGQKLLDFCAECLDSFIRETLGRTEEDPILPLGFTFSYPCSQLRIDHGVLIRWTKGFGAP
NIEGRDVAEMFKDSLKRFNVQAELLALINDTTGTLIASNYVDPNTKIAVIFGTGCNAAYM
ETAEMIPKMSSVGLPHGQGMAINCEWGAFDSFDHQHLPRTKYDIIIDESSNKPGEQSFEK
MIAGLYLGEVFRLILCELIDAGDLFLGQNTYKLEKAYAFDTAFLSLMESDPTDELLTIIG
VFTHFFGLETTIEERQFFKRLAMLIGTRAARLSACGIAAIVSKKGYLEKGCSVGADGSLY
NKYPHFADRVHSALVDIFGEKGRRITTHHAEDGSGVGSAIIAAMTKARKDEGFFVNY
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaggaatagtagtagtaattctttagctggtgtacaagataacggtaccaacctc
ggttctttagctggtagaagagctagtcaaactatcttttcaatggaaagaaggactagt
caaggtggtccaaggagtagaagaggtagtggagctgttttaactcctagtggaacaacg
gtggtttatcatactaggactaatgcggatgtggaattccctcacatcgagaagaaaact
attgcagatcagttgaggaaatatgagagtatcctgactctttcaccccaacgaatgcgt
atgatcgtacatgccatcgaagagtccctcgacaaaggtttacagaaagatggtcagatt
ctgatacatccagtcccgacctttgtctttggatggcccagcggagaagaaatgggcgaa
tatctagctctagacctcggaggtaccaatctacgtgtatgtctcgtcactctacaaggc
ctcggaaagttcgaagtcactcagacgaaatatcgtttgaccgaagaacagaaacaagaa
gatggtcagaaactattggacttttgtgcggaatgtttagacagttttatccgtgaaact
cttggacgaactgaagaggatcctatcttgcccttgggtttcacgttttcttacccttgc
tcgcagttgcgtattgatcatggagtgcttatccgttggaccaaaggtttcggcgctccg
aatatcgaaggacgtgatgtagcagaaatgttcaaggattctttgaaacgatttaacgta
caagcggagcttctcgctttgatcaatgacaccacgggtactttgatcgcttccaactat
gtcgatcccaacaccaaaatcgccgtcatattcggtactggatgtaatgccgcatatatg
gagacggcggagatgattcccaaaatgtcatctgtcggcttgcctcatggacaaggtatg
gcgattaactgcgaatggggagcgttcgactcgttcgaccatcaacatctacctcgaaca
aaatacgacatcatcattgatgaatcgtctaacaaaccgggcgaacaatctttcgaaaag
atgatagctggactttacctcggagaagtattcaggttgatcttatgtgaactgatcgat
gcgggggatttgttcttgggtcagaatacgtacaagttggagaaagcttatgcttttgat
actgctttcttgagtttgatggagagcgacccgactgacgaacttctcactatcatcggc
gttttcacccatttcttcggactggagacgactatcgaagaacgacaattcttcaaaaga
ctcgctatgctcattgggacccgtgcggctagactttcagcctgtgggatcgcagcgata
gtcagtaagaaggggtatttggagaaagggtgtagtgtgggagcggatgggtctttgtac
aataaataccctcacttcgccgatcgggtccattccgccttggtggacatttttggagag
aagggaaggaggatcaccactcatcatgctgaagatggatcaggtgtgggtagcgccatc
atcgccgcaatgaccaaggcgaggaaagacgaaggattctttgtcaattattaa

DBGET integrated database retrieval system