KEGG   Tremella mesenterica: TREMEDRAFT_41411Help
Entry
TREMEDRAFT_41411  CDS       T03139                                 

Definition
(RefSeq) hypothetical protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tms  Tremella mesenterica
Pathway
tms04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:tms00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    TREMEDRAFT_41411
Enzymes [BR:tms01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     TREMEDRAFT_41411
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 18493236
NCBI-ProteinID: XP_007000907
JGI: Treme1_41411
LinkDB All DBs
Position
Unknown
AA seq 227 aa AA seqDB search
MVLLLRTTVRHAAKLPLQTLRTGSMSVRGKHSLPPLPYAYDALEPSISAEIMTLHHTKHH
QTYVNGLNAAEEALANFQASGDIRGAIDLQAALKFNGGGHINHSLFWTNLAPTGSEAAKP
NPSSTFIKQVEVDFGSLDNLKSEMNTKTAAIQGSGWGWLGWNKKAKKLEIATTPNQDPLL
SLVPIIGIDIWEHAFYLQYKNVKPDYLKAIWDVINYEEADKRLQAAM
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggtccttcttctgcgaactacagtcagacacgccgcaaaactacctcttcaaactctt
cgaaccgggtcaatgtctgtcagagggaaacattctctccctccactgccttatgcgtac
gacgccctcgaaccgtctatatcggcagagattatgacccttcaccataccaagcatcat
cagacctacgtcaacgggttgaacgctgctgaagaggctcttgcaaatttccaagcttcc
ggtgatatcaggggtgctattgatcttcaggcagctctcaaattcaatggaggtggacac
attaatcactcgctgttttggaccaatctcgcccctaccggatcagaagccgctaaaccc
aatccctcttcgactttcatcaagcaagttgaagttgatttcgggtctcttgacaacctc
aagtctgagatgaacaccaagaccgccgccatccaaggatccggctggggctggttggga
tggaacaagaaggcgaaaaagctcgaaatcgctacgacgcctaaccaagatccgttgttg
agcttggtccccatcattggcattgatatctgggaacatgctttctatcttcagtacaag
aacgtcaagccggattatctcaaggccatatgggatgtcatcaattatgaagaagctgat
aagcgtctccaggctgccatgtga

DBGET integrated database retrieval system