KEGG   Tremella mesenterica: TREMEDRAFT_41668Help
Entry
TREMEDRAFT_41668  CDS       T03139                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
tms  Tremella mesenterica
Pathway
tms00250  Alanine, aspartate and glutamate metabolism
tms00410  beta-Alanine metabolism
tms00430  Taurine and hypotaurine metabolism
tms00650  Butanoate metabolism
tms01100  Metabolic pathways
tms01110  Biosynthesis of secondary metabolites
Module
tms_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:tms00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    TREMEDRAFT_41668
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TREMEDRAFT_41668
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TREMEDRAFT_41668
   00430 Taurine and hypotaurine metabolism
    TREMEDRAFT_41668
Enzymes [BR:tms01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     TREMEDRAFT_41668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 18493267
NCBI-ProteinID: XP_007000938
JGI: Treme1_41668
LinkDB All DBs
Position
Unknown
AA seq 512 aa AA seqDB search
MQNGHQVAEQPYQSRTHNAEQFEELLDAVREELTPFIRAADQSSSNKHALSSSRTLVNPL
QPRALTEQLDLDLPQVGTGTPGLLQAIQDVLRGSVNTWDQGFMDKLYASTNPVGVISELV
LAVLNTNVHVYHVSPALTLIEKKVSRALADLFGFNGPHGGGISQPGGSASNMSSIIVARN
TLFPHTKKRGLVGLKPVLFTSAHGHYSLEKAAQIMGFGSDACRSVSCDEDGRMIPSELRR
QIKQAIQQDEAPFYVNATAGTTVLGSFDPLEAIADICEEFHLWMHVDGSWGGSVVFNSSI
GQGRLDGIHRANSITISPHKMLGVPITCSFLLGRDMRQFHRAMTLPAAYLFHEDANEDGK
IYDLADLTPQCGRKGDALKVYLSWTFYGAQGYSDRIARAYARADDFVTQLEKSPNTYLVS
RRPLPCLQVCFYYTPGRLLSDNVTNSRRTEDMVRRLLHRGFMIDFASGKNGKFIRVVING
DTLPGTVEALLECIEEEGNRLLDQEMHQGLVL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatggccatcaagtagcagagcagccgtaccagtccaggactcacaacgcggag
cagtttgaagagcttctcgatgccgtacgggaagagttgacacctttcatccgtgccgca
gaccaatcgtcctcaaacaagcatgctctctcttctagtcgtaccctcgtgaacccgtta
caacctcgcgccttgacagagcagctggatttggatttaccgcaagtaggaactggcact
cctggacttcttcaagcaatacaagatgtgctccgaggaagtgttaatacttgggatcag
gggttcatggacaagctatatgcctccacaaacccagttggtgtcatctccgagctcgtt
ttggcagttttaaacaccaatgtacatgtctatcacgtctctcctgccctgacattgatc
gagaagaaggtcagccgggctctagcggatctctttggcttcaatggtcctcatggtggt
ggtatctctcaaccgggtggttcagcgtcaaacatgtcatccatcatcgtggctcgtaac
actctgtttccccatacgaagaaacgaggtttggtgggcttgaaaccagtcctctttact
tctgcccatggacattattcactagagaaagccgcccaaatcatgggatttggaagtgat
gcttgtcgatcggtgtcatgtgatgaagatggtcgaatgattccttccgagttacgtcgt
cagatcaagcaagcgatacaacaggacgaagcacctttttatgtgaacgcgacagccggt
accaccgtactgggaagttttgaccctttggaagccatagccgatatttgtgaggaattt
catctgtggatgcacgtcgatggaagttggggagggagcgtcgttttcaactcttccatt
ggacaaggtagactggacggaattcatcgtgccaacagcatcaccatcagtccacacaag
atgctcggtgtcccgataacatgctctttcttgcttggcagagatatgcgacagtttcat
cgagccatgacgcttcccgcagcttatctcttccacgaagacgccaacgaagatggtaaa
atatacgatttggcagatctgacaccgcaatgtggacgcaaaggagatgctctcaaagta
tacctttcatggacgttctacggagctcaaggatactcggacaggattgcaagagcatac
gcccgggcagatgactttgtcactcagttggagaaatccccgaatacatacttggtgtct
cgaagaccgctgccctgtttgcaggtatgcttttactataccccgggaagactcctctct
gataacgtcaccaatagccggcgtaccgaggacatggtgagaaggctgctacacagaggc
tttatgattgactttgcgtctggcaaaaatggcaagttcatcagagtcgtgatcaacggg
gatacattgcccggcacggtcgaggctctgctcgagtgcatcgaggaggaaggtaacagg
ttattagatcaagagatgcatcagggactcgttttataa

DBGET integrated database retrieval system