KEGG   Tremella mesenterica: TREMEDRAFT_44568Help
Entry
TREMEDRAFT_44568  CDS       T03139                                 

Definition
(RefSeq) superoxide dismutase Cu-Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
tms  Tremella mesenterica
Pathway
tms04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:tms00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    TREMEDRAFT_44568
Enzymes [BR:tms01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     TREMEDRAFT_44568
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-GeneID: 18493637
NCBI-ProteinID: XP_007005372
JGI: Treme1_44568
LinkDB All DBs
Position
Unknown
AA seq 154 aa AA seqDB search
MVKAVAVLKGDSSVIGTITFTQEKEGGPVEVSGEIKNLDANAERGFHIHQFGDNTNGCTS
AGPHYNPHGKTHGAPTDSERHVGDLGNVKTDAQGTATIKISDKVISLFGGESIIGRTVVV
HAGVDDLGKGGHADSLVTGNAGGRAACGVIGIAA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaagcagtagctgttcttaaaggagattcttccgttattggaactatcaccttt
actcaggaaaaagaaggtggtcctgttgaagtttctggcgagatcaaaaacctcgacgcc
aacgccgaaaggggtttccacattcaccaattcggggataacaccaacggatgtacttcc
gctggacctcattacaaccctcatggtaagacccacggtgctcctacagattccgagagg
catgtcggtgatcttggaaacgtcaagacggacgcacagggaactgctaccatcaagatc
tctgacaaagtgatttcgttgttcggcggggaatccatcatcggtcgtaccgtcgtcgtg
cacgccggcgtggatgatctcggtaaaggaggtcatgcagactcgcttgttactggaaac
gctggtggtcgcgctgcctgcggtgtcattgggattgccgcttga

DBGET integrated database retrieval system