KEGG   Tremella mesenterica: TREMEDRAFT_67336Help
Entry
TREMEDRAFT_67336  CDS       T03139                                 

Definition
(RefSeq) hypothetical protein
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
tms  Tremella mesenterica
Pathway
tms03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tms00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    TREMEDRAFT_67336
Enzymes [BR:tms01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TREMEDRAFT_67336
DNA repair and recombination proteins [BR:tms03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     TREMEDRAFT_67336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 BRCT RNA_ligase LIG3_BRCT DNA_ligase_A_C PTCB-BRCT
Motif
Other DBs
NCBI-GeneID: 18497811
NCBI-ProteinID: XP_007001946
JGI: Treme1_67336
LinkDB All DBs
Position
Unknown
AA seq 1047 aa AA seqDB search
MPPTVWRRDRRISPSTAQDGEEAKSADSGVLPPGPSTLERPKDCVNKNPTPAFSLLCTVM
DRLRSEEMSKRKDTLTRFFNLWRIKVGNDLYPLIRLLLPERDRERPVYNLKEAMLAKCYI
EVLGLDKHSAAAQKLVKWKQPVDGETDGISGDFARVCYHEIAARSTVEEGTLTLEAVNAL
LDQLAGGRMKQAEYVPILRSINRQCTPVEQEWIIRIILKDLRISIREKGVFSCFHPDAAD
LFNVCSDLKRVCWTLYKPDVRLEKNQTNIELFRSFLPQLCYRSPSSAHDAIARLVGAPNQ
EFVMEEKLDGERMQLHMRGNGAQWFYCSRKAKDYTYLYGAHIGEGSLTQHIAGAFHDDVR
NIILDGEMLVWDPQLEKYLAFGVLKTFAQDKIIDDTAPRPCFKVFDILYLNDKCLTGKRL
SERKRLLHSNRVFKDIDQYKGRLEFAAEERGKSGKDIRAMLEKILESRGEGLVVKKLDST
YQTNSRGQDWVKVKPEYADQMGETLDVMVLGGWWGKGGRTGKLSSMLCGLRVQRDDEGDG
GIPQFATFCRVGSGMSYSDYEWILNKHREHWKTFKRSNPPSWMKMGEIGLDDSPDVYIEP
EHSFVMQVKASEIVPATGNFGIGYTLRFPRCKFIFYDTASRDHPVEDPEMERDMWNCLSV
EEFTELLNKPKRKYEDDEQGSKRRKRKPVTRTKVQLISSVKGQLLSQEEVESGIFDNMKF
YVVKGDNKNSKAELEALIHEHGGDFTQAQLSDLSAIVIAPDDKSPLLRAQKKKGVSIVKP
SWIYESIKRKKPLPMIEGLLVFASEDDQAGPLYHKTLDELDEMATRDGSSGADAHEASSG
SRHSSQDARNGMMSAEKGGRPVKSSKQQAMENEWDLDKIAPSTTVTNDVPSRAEDNDEEA
SAESHASDEEIDEPLFPIRSGSTGEGMGDAETNDYDEDKIFNHLVFYIDTTENTKKNGLA
GSPPSSEVIERLDNARKLLIENGGKVVDNINEPKLTHIIMDDDDSSRYGELSWKTSKPKR
KHIVLPSWVTECVEEETLMNEDAHRPR
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atgccccctactgtgtggagaagagacaggcgtatatctccttccactgctcaagatggt
gaagaagcgaaatcagcagattctggtgtactcccccccggtccttcaactctggaacgt
cccaaggattgcgtcaataaaaaccccacacctgctttctccctgttatgcaccgttatg
gatcgtttgaggagcgaagaaatgagcaaacgtaaggatacgttgacgagattcttcaac
ctctggcggattaaagtgggtaacgacctctatcctctcattcgattactcttgcccgag
agggatagggaaagacctgtgtataatctcaaagaagctatgcttgctaaatgctacatt
gaggttctggggctggacaagcacagtgcagcagctcaaaaactggtcaagtggaagcaa
cctgttgatggggagacggacggcatctcgggagattttgctagggtctgctatcacgag
atagccgctaggtctacggtggaagaaggaacattgacccttgaagctgtcaacgcttta
ttggatcagcttgccggtggaaggatgaagcaagctgaatatgtcccgatactccgaagc
ataaaccgacaatgtacacctgttgaacaagaatggatcatacgaatcatccttaaagac
cttcgtatttctatccgggagaaaggggtgttttcatgttttcatcccgacgcagctgat
cttttcaacgtttgttcggatctcaagcgtgtatgctggacattgtacaagccagacgtt
cgtttggagaagaatcaaacgaatatagaattattcagatctttcttaccccagctgtgc
tatcgctccccctcttcagcccacgatgcgatcgcgagattggtgggagctcctaatcaa
gagttcgtcatggaagagaaattggatggagaaagaatgcaactgcacatgcgaggtaat
ggagcgcagtggttttactgctctaggaaagcaaaggattacacatacctttacggggcc
catatcggagaaggcagtttgacacaacatatcgcgggcgcctttcatgatgacgtacgt
aacatcatcctcgatggcgagatgttagtatgggatcctcagctcgagaaatatctcgcc
ttcggtgtactgaagacatttgctcaggacaagataatcgacgatacggcgcccagaccc
tgctttaaggtcttcgatatactctatctcaacgacaagtgtctcactggcaaacgactg
tcggaacgtaaacgattactgcattccaatagggtattcaaagatatcgatcagtacaag
ggcaggttggaattcgctgctgaggaaagagggaaatcagggaaagatatccgtgcaatg
ttggaaaagatcttggagtcaagaggtgaaggtctggtagtgaagaaattggacagcacg
tatcagacaaattcccgagggcaagactgggtcaaagtcaaacctgaatatgccgaccaa
atgggagagacacttgacgttatggtccttgggggctggtggggcaagggaggacgtact
ggtaaactatccagtatgctctgtggtctgagggtgcagagggacgatgaaggtgacgga
ggtattccacaattcgccactttttgtcgtgtaggctctggaatgagttattcagactac
gagtggatactgaacaaacatcgagagcattggaaaactttcaaacgctccaatcccccc
tcatggatgaaaatgggcgagataggtttggacgactctccggacgtgtacattgaacct
gaacactcattcgtcatgcaggtcaaagcatccgagattgtccctgccacaggaaacttt
ggtataggttacaccctccgattcccacgatgtaaattcatcttttacgataccgctagt
cgagatcatccagtggaggatcctgaaatggaacgagacatgtggaattgtttgagcgtg
gaagaatttacggagctactcaataaaccgaaacgcaaatatgaagatgatgaacaagga
tcgaagagaaggaaacgaaaaccagtgactaggactaaagttcaattgatttcctctgtc
aaaggtcaacttttgtcccaggaagaagtcgaaagtgggatatttgacaatatgaaattt
tacgttgtgaagggtgataacaagaattccaaggcagaacttgaagcgttgattcatgaa
cacggaggagattttacgcaagctcaattatctgatctttcggcaatcgtcattgcgcct
gatgataaaagtccattgctcagagctcagaaaaagaagggagtcagtattgtcaaacct
agctggatttacgagtctatcaaaaggaaaaagccattaccgatgattgagggacttctc
gtcttcgcttcagaagatgaccaagcgggacctttgtatcacaagactttagacgaactc
gacgaaatggccactcgggatggttcatcaggagccgacgcgcatgaggcttcatctggc
agtcgacatagctctcaagacgcacgaaatgggatgatgtctgctgaaaaaggcggaaga
cccgtaaaatcatctaagcagcaagcaatggaaaatgaatgggatcttgacaagattgca
ccgagtactactgtcaccaatgacgttccctctcgggctgaagacaacgatgaagaagca
tccgctgagagtcatgcgagtgatgaagagatcgacgagcctttgttccccatccgaagt
ggttcaacaggagaaggaatgggtgatgcagagactaacgactatgacgaggataagatc
ttcaatcatttggtattttatattgacactactgaaaataccaaaaagaacggtttggcc
ggttctcccccttcatcggaggtcatcgaaagattggataatgcgaggaagttgttgatt
gagaatggagggaaagtggtggataatataaatgaaccgaaattgactcatatcatcatg
gacgatgatgattcaagtaggtatggagaattgagttggaagacttctaaaccgaaacga
aaacatatagtgttaccgtcttgggtgacggaatgtgtagaagaggaaactttgatgaat
gaagatgctcatagaccacgttga

DBGET integrated database retrieval system