KEGG   Tremella mesenterica: TREMEDRAFT_73331Help
Entry
TREMEDRAFT_73331  CDS       T03139                                 

Definition
(RefSeq) hypothetical protein
  KO
K02358  elongation factor Tu
Organism
tms  Tremella mesenterica
Brite
Translation factors [BR:tms03012]
 Eukaryotic Type
  Elongation factors
   TREMEDRAFT_73331
 Prokaryotic Type
   TREMEDRAFT_73331
Mitochondrial biogenesis [BR:tms03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    TREMEDRAFT_73331
Exosome [BR:tms04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TREMEDRAFT_73331
  Exosomal proteins of breast cancer cells
   TREMEDRAFT_73331
  Exosomal proteins of colorectal cancer cells
   TREMEDRAFT_73331
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 18498946
NCBI-ProteinID: XP_007003137
JGI: Treme1_73331
LinkDB All DBs
Position
Unknown
AA seq 469 aa AA seqDB search
MISTRLQSSILSAARGAADLCYVSARPLAGPSSLVSVRSLSTRPNVTSIRAPRLAVLPRG
ISRRGYAAEASKTFQRSKPHFNIGTIGHVDHGKTTLTAAITKLMSEQGGGKFMDYSQIDK
APEEKARGITISTAHVEYETKNRHYAHIDCPGHADYIKNMITGAAQLDGAIIVVSATDGQ
MPQTREHLLLARQVGIKKLVVFINKVDQVDDPEMLELVEMEMRELLGQYGYDGENTPIVM
GTALAALEGKDPERGSQKIQELMNAADTWLDVPARDLDKPFLMYVEDVFSISGRGTVVTG
KVERGTITKGAEVEIVGLGTSLKTTLTGIEMFHKELERGEAGDNMGALLRGIKREQVRRG
QVLVAPGSIKSVKKFKAQIYVLTKDEGGRYTPFMAHYRPQLFIRTTDVTVSLTFPEGTPN
AFEKLVMPGDTVEMIGELVHDIALEQGSRFTLREGGKTVGTGIVSEIYT
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgattagcactcgtctacaaagcagcattctttcggctgctcgtggtgccgccgatttg
tgctatgtctctgctcgaccattagctggaccctcatcactcgtgtccgtccggtcatta
tccaccaggcctaatgttacatcgatccgggctccacgactggccgtcctaccacgagga
atatcacgtaggggatacgcagcggaagctagcaagacattccagcgtagtaaacctcat
ttcaatatcggtaccattggtcatgtcgatcatggaaaaaccaccctgacagctgcgatc
accaagcttatgtctgagcagggaggtgggaaattcatggactatagtcagatcgataag
gctcctgaagaaaaggctcgagggattaccatcagtacggcgcacgtggagtatgaaacg
aaaaacaggcattatgcacacatcgactgtcctggtcatgccgattatatcaaaaacatg
atcactggcgccgctcaactcgatggtgccatcatcgttgtctccgctaccgatggtcaa
atgcctcaaacccgagaacatctcctcctcgctcgtcaagtcggtatcaaaaaactcgtt
gtgttcatcaacaaggtcgaccaagtggatgacccagaaatgttggagctggtagaaatg
gaaatgcgcgaattacttggtcaatatggatatgatggagagaacacaccgattgtcatg
ggcactgctttggcggctctggaggggaaagatccagagagaggctcgcagaaaatccag
gaattgatgaatgctgctgatacttggttggatgtaccagctcgtgatctcgacaaacca
ttcttgatgtacgtcgaggacgtgttctccatctctggtcgtggtaccgtcgtcactggc
aaagtcgaacgagggaccatcaccaagggagctgaagtggaaattgttggtctggggact
tcactcaaaacgactttgacaggtattgaaatgttccacaaggagctcgaacgcggtgag
gcaggcgacaatatgggtgctctcttgcgaggtatcaagcgtgaacaagtacgcagaggt
caagttttggtcgctccgggctcgatcaagagtgtcaaaaagttcaaggcgcagatctat
gtcctcactaaagatgaaggtggacgttacactcccttcatggcccactaccgacctcag
ctgttcatccgtacgaccgacgttaccgtatctctcacttttcccgaaggcaccccaaat
gctttcgagaagctcgtgatgcccggagacactgttgaaatgatcggagagctcgtgcat
gacatcgcccttgaacaaggtagtcgttttacattgcgtgaaggaggtaaaactgttggg
actggtatcgtctccgagatctacacttag

DBGET integrated database retrieval system