KEGG   Thermoanaerobacter mathranii: Tmath_0492Help
Entry
Tmath_0492        CDS       T01250                                 

Definition
(GenBank) ABC transporter related protein
  KO
K02003  putative ABC transport system ATP-binding protein
Organism
tmt  Thermoanaerobacter mathranii
Brite
KEGG Orthology (KO) [BR:tmt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tmt02000]
    Tmath_0492
Transporters [BR:tmt02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Putative ABC transporter
    Tmath_0492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_25 AAA_29 RsgA_GTPase AAA_16 AAA_22 T2SSE Rad17 AAA_23 NB-ARC AAA_18
Motif
Other DBs
NCBI-ProteinID: ADH60251
UniProt: D7ASM7
LinkDB All DBs
Position
515057..515725
Genome map
AA seq 222 aa AA seqDB search
MVILKTEKLFKEYNVEGNVTKVLNGIDLEINEGEFVSIMGPSGSGKSTLLYVLSGLEKPT
SGSIFFKGEDLTLLNDDKLSKLRRREFGFIFQFYNLIPNLNVEENITLPLEFEGINRKEY
NSNIDKILERVGLIEKKQNFPYQLSGGQQQRVAIARALIIDPKIIFADEPTGNLDSKAGE
EILKLLYNLSKENNKTVLMVTHDNYAASFSDRIIKIKDGVIE
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggttattttaaagacagaaaaattatttaaagaatacaatgtggaaggaaatgtgaca
aaagttcttaatggtattgatttagaaatcaatgaaggagagtttgtttctattatggga
ccgtctggctcagggaaaagtactttgttgtatgtacttagtggtttagaaaaacctact
tctggtagtatcttttttaagggagaagatttaactttgttaaatgatgataaattgagt
aaattgagaagaagagaatttggttttatatttcagttttataatttgatacctaattta
aacgttgaagaaaacataacactccccttagagtttgaaggaataaataggaaagaatat
aatagcaatattgataaaattttagaaagggtcggattaattgaaaaaaagcagaatttt
ccttatcaattatcgggaggacagcaacaacgagtggccattgcaagagcgctgataatt
gatcctaaaataatatttgcggatgagccaactgggaatcttgattcaaaagcgggagaa
gaaattttaaagcttctgtataatttgagtaaagaaaataataaaacagtattaatggtt
actcatgataattatgctgcatccttcagcgataggataattaaaataaaagatggggta
attgagtga

DBGET integrated database retrieval system