KEGG   Thermoanaerobacter mathranii: Tmath_1560Help
Entry
Tmath_1560        CDS       T01250                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
tmt00010  Glycolysis / Gluconeogenesis
tmt00051  Fructose and mannose metabolism
tmt01100  Metabolic pathways
tmt01110  Biosynthesis of secondary metabolites
tmt01120  Microbial metabolism in diverse environments
tmt01130  Biosynthesis of antibiotics
tmt01200  Carbon metabolism
tmt01230  Biosynthesis of amino acids
Module
tmt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tmt_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmath_1560
   00051 Fructose and mannose metabolism
    Tmath_1560
   00562 Inositol phosphate metabolism
    Tmath_1560
Enzymes [BR:tmt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tmath_1560
Exosome [BR:tmt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tmath_1560
  Exosomal proteins of bladder cancer cells
   Tmath_1560
  Exosomal proteins of melanoma cells
   Tmath_1560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADH61269
UniProt: D7AQ28
LinkDB All DBs
Position
complement(1549552..1550322)
Genome map
AA seq 256 aa AA seqDB search
MTSKGVFALRRPIIAGNWKMHMTPSEAVKLVEELIPQVKEAKAEVVVIPPFVDLTEVSKV
IKGTNILLGAQNMFWEEKGAYTGEISPLMLKEIGVKYVVIGHSERRQYFGETDETVNKKV
LSALSHGLSPIVCVGESLSQREEGKTFEVVLSQTKEALKGVSPDDIVRVVIAYEPIWAIG
TGKTATAEDANEVIKAIRNTIASLYGKEKASLVRIQYGGSVKPENISELMAESDIDGALV
GGASLVATDFAKIVNY
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtaaaggggtgtttgctttgagaagaccaataattgcaggtaattggaaaatg
cacatgaccccttctgaagctgtgaagttagttgaggaattgatacctcaagtaaaagag
gcaaaagcggaagtggtagtcatacctccttttgtggacttgacagaagtgagcaaagtc
atcaaaggtacaaatattcttttgggtgctcaaaatatgttttgggaagaaaagggtgca
tatacaggagaaatttcgcctttaatgcttaaagagattggcgtgaaatacgttgtaata
ggtcactctgaaagaaggcagtattttggtgagacggatgaaacggtaaataaaaaagtc
ttatccgctctatctcacggcttaagtcctattgtgtgtgtaggagaatctctttctcaa
agagaagaaggaaaaacttttgaagtagttttaagtcaaactaaagaggcattaaaaggc
gtttcgccagatgacatcgtcagggtagtaatagcttatgagccaatttgggctataggt
actggcaaaacggctacagctgaagatgccaatgaagtcataaaagctataagaaatact
atagcttccctttatggaaaagaaaaagcaagtttagttagaatacagtatggggggagt
gtaaaaccagaaaacatctctgaactcatggcagaaagcgatatagatggggctttagta
gggggagcaagtcttgtagcaacagattttgcaaagattgtcaattattaa

DBGET integrated database retrieval system