KEGG   Thermoanaerobacter mathranii: Tmath_1806Help
Entry
Tmath_1806        CDS       T01250                                 

Definition
(GenBank) ABC transporter related protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
tmt  Thermoanaerobacter mathranii
Brite
KEGG Orthology (KO) [BR:tmt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tmt02000]
    Tmath_1806
Transporters [BR:tmt02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    Tmath_1806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 DUF4162 AAA_23 AAA_15 AAA AAA_30 AAA_33
Motif
Other DBs
NCBI-ProteinID: ADH61504
UniProt: D7ARG2
LinkDB All DBs
Position
complement(1815383..1816360)
Genome map
AA seq 325 aa AA seqDB search
MMIELKNVTKVYGTRKAVDNISFSVDKGEIVGFLGPNGAGKTTTMKMITGYMPPTSGTIK
IAGYDIVEQPIEAKKHIGYLPEVPPLYLDMTVEAYLHFVGGIKGIPTKKIREDVERIIHE
VGLTDVRKRLIKNLSKGYKQRVGLAQAIIGDPNVLILDEPTVGLDPKQIKEIRDIIKELG
KRHTIILSTHILPEVSMVCDRVIIINKGKIVAIDKTENLSAALKNSRRYFIKVEGPYEEV
ANSVKEIEGVTNVEAEVDADNTIKLTVESSADKDVRKDMFFAFAKKGFPILELKVLNYSL
EEIFLELTTEEESYDENVGNTKEGA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgatgatagagctaaaaaacgttacaaaggtttatggcactcgtaaagcagtagataat
ataagtttttcagtagataaaggagaaatagttggttttttggggcccaatggggctggt
aaaactactactatgaaaatgataacaggatatatgcctcctaccagtggtactataaag
attgcaggatatgatattgtggaacaaccgatagaggcaaagaaacatattggttattta
ccagaggtacctcctttgtatttagatatgaccgtagaagcatatctccattttgtggga
ggtataaaaggtattcctactaaaaagataagagaagatgttgaacgaattatacatgaa
gttggtttgactgatgtgagaaaaagacttataaaaaatttgtctaaaggttataaacaa
agggttggacttgcacaagcaataataggagaccctaatgttttgatattagatgagccg
acagtaggtcttgaccctaagcaaattaaagaaataagagatattataaaagaattaggg
aaaaggcatacaataattttaagcactcatatattgccagaagttagtatggtgtgtgac
agagttattataataaataaggggaaaattgttgcaatagataagacagagaatttatca
gctgcattaaaaaattcaaggagatattttataaaagtggaagggccttatgaagaagtg
gcaaacagtgtaaaagagattgaaggagtaactaatgtagaagcagaagttgatgcagat
aatacgataaagctgacagtggaatcttctgctgataaagatgttcgaaaagatatgttt
tttgcttttgccaaaaaaggcttcccaatattagaacttaaagtactaaattatagtctt
gaagaaatattcttagaacttacaacagaggaggaaagttacgatgaaaatgtgggaaat
actaaagagggagcttaa

DBGET integrated database retrieval system