KEGG   Thermoanaerobacter mathranii: Tmath_1831Help
Entry
Tmath_1831        CDS       T01250                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
tmt00473  D-Alanine metabolism
tmt01100  Metabolic pathways
tmt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tmt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Tmath_1831
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Tmath_1831
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tmt01011]
    Tmath_1831
Enzymes [BR:tmt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Tmath_1831
Peptidoglycan biosynthesis and degradation proteins [BR:tmt01011]
 Precursor biosynthesis
  Racemase
   Tmath_1831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C PfUIS3
Motif
Other DBs
NCBI-ProteinID: ADH61529
UniProt: D7ARI7
LinkDB All DBs
Position
complement(1853781..1854938)
Genome map
AA seq 385 aa AA seqDB search
MFDNIRPTRAEIYLDNIAHNLSEVKRWVGKKVKIMGVVKANAYGHGACHVAKVLVENGVC
YLGVATIEEALELRECGINIPILVFGYTPLTQAEELIVHNITQTVFDINYVEDLEKIALN
VGKKAKVHVKIDTGMGRIGYTDLKVAEKEIEKMMEMEGVEVEGIFSHFATSDEKDKSYAE
QQFDMFKKLLERLKEKRINIPLKHMANSGAIIDLKYTYLDMVRPGIVLYGSYPSEEVKRP
LDLRQTMGFKTKIVYIKEVPEGTSISYGKTFITKRKSKIATLPVGYADGFNRLLSNNYHV
LVKGKYAAVVGRICMDQTMIDVTDIEGVEVGDDVIIFGNQEGEKITAEEIAKKLNTIPYE
VYCGISSRVPRIYIYKGKVVGEKII
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtttgataatataaggccaacaagagcagaaatatatttggataatatagcgcataat
ttgagtgaagtaaaaagatgggtgggcaagaaagtaaaaataatgggtgtagtgaaagcc
aatgcttatggtcatggcgcttgtcacgtagcaaaagtcttggtagaaaatggggtttgc
tatttgggggtagcgacaatagaagaggcgttagaattaagggaatgcggaattaatatt
cccatactcgtttttggatatactcctttaactcaggccgaagaattaattgtgcacaat
ataactcaaactgtttttgatataaactatgttgaagacttagaaaaaattgctttaaat
gtgggtaaaaaagctaaagtacatgtaaaaattgatacaggcatgggacggataggatat
acggatttaaaggtagcagaaaaagaaatagaaaaaatgatggaaatggaaggggtagag
gtagaaggtatatttagtcattttgctacttctgatgaaaaagataagagctatgctgaa
caacagtttgatatgttcaaaaaattattagaaaggttaaaagaaaaaaggataaacatt
cctttaaaacatatggctaacagtggagcaattattgaccttaaatatacttatttagat
atggtgagaccaggaatagttctatacggtagttatccttcagaagaagtcaaaagacca
ttggatttaagacagactatgggttttaaaactaaaatagtatatataaaagaagtgccc
gaaggcacttccataagttatggaaagacatttataactaaaagaaagagtaaaattgct
accttgcctgtagggtatgctgacggttttaatagattactttctaataattatcatgtg
ctagtgaaagggaaatatgctgctgtggttggaaggatttgtatggaccaaacgatgata
gatgttaccgatatagaaggagtagaagtaggtgatgatgtaattatttttggaaatcaa
gagggagaaaaaataacagctgaggagattgctaaaaaattaaatactataccttatgaa
gtatattgtggaatatccagcagggtacctcgaatatatatttacaagggaaaggtagtt
ggggaaaaaattatttaa

DBGET integrated database retrieval system