KEGG   Thermoanaerobacter mathranii: Tmath_1903Help
Entry
Tmath_1903        CDS       T01250                                 

Definition
(GenBank) ABC transporter related protein
  KO
K16786  energy-coupling factor transport system ATP-binding protein [EC:3.6.3.-]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
tmt02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:tmt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Tmath_1903
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tmt02000]
    Tmath_1903
Enzymes [BR:tmt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     Tmath_1903
Transporters [BR:tmt02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter
    Shared module
     Tmath_1903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_24 AAA_29 AAA_22 AAA_15 TniB AAA_18 AAA_23 ATPase RNA_helicase MeaB AAA_14 AAA_5 AAA_16 RsgA_GTPase NB-ARC AAA_33 Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: ADH61590
UniProt: D7ARP8
LinkDB All DBs
Position
complement(1928458..1929291)
Genome map
AA seq 277 aa AA seqDB search
MEHIITTQNLSFEYHTEEQTRHLVLKDINLQFKKGQFIGIIGHNGSGKSTLAKHFNALLV
PTEGKVYVKGMDTKDAKHLWDIRQTAGLVFQNPDNQIVAAIVEEDVAFGPENLGISPDEI
KERVEYALKAVGMWEYKDYPPHMLSGGQKQRVAIAGIIAMKPECIILDEPTAMLDPIGRR
EVISTIKKLNKEEEITVILITHFMEEVVDADRVIVMDDGKVVLDGTPKEVFKEVELLKKI
GLSVPQVTELAYQLKREGFDVPLDILTVEEMVEFLCR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggaacacataataacaacacaaaatttatcttttgaatatcatacagaagaacaaact
cgacacctagttttaaaggatataaatttacagtttaaaaaaggacagttcataggtata
attggccataatgggtcaggtaaatcaacacttgccaaacattttaatgcacttttagtg
ccgacagagggaaaagtgtatgtaaagggaatggacacgaaagatgcaaagcatttatgg
gacataagacagactgctgggcttgttttccaaaatccagataatcaaatagtggcggct
atagttgaggaggatgtagcttttggcccagaaaatttaggtatatcccctgatgagata
aaagaaagagttgaatatgctcttaaagcggtaggtatgtgggaatacaaagattatcct
ccccacatgctttcaggcggccaaaagcaaagagttgctattgctgggataattgcaatg
aaaccggagtgcataattttggacgaaccaacggcaatgcttgacccaataggaagaagg
gaagtaatttctaccataaaaaaactcaacaaagaagaggaaattactgtaatactcata
acacattttatggaggaagtagtagatgcagatagagttattgtaatggatgatggaaag
gtagtgttagatggtactcctaaagaggtatttaaagaagttgagcttttaaaaaagatt
ggcctcagtgtgccccaagttacagagttggcataccaattgaagagagaaggctttgac
gtccctctagacattttaacagtagaagaaatggtggaatttttatgccgataa

DBGET integrated database retrieval system