KEGG   Trichechus manatus latirostris (Florida manatee): 101340589
Entry
101340589         CDS       T05135                                 

Definition
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu01522  Endocrine resistance
tmu01524  Platinum drug resistance
tmu04010  MAPK signaling pathway
tmu04012  ErbB signaling pathway
tmu04014  Ras signaling pathway
tmu04015  Rap1 signaling pathway
tmu04022  cGMP-PKG signaling pathway
tmu04024  cAMP signaling pathway
tmu04062  Chemokine signaling pathway
tmu04066  HIF-1 signaling pathway
tmu04068  FoxO signaling pathway
tmu04071  Sphingolipid signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04114  Oocyte meiosis
tmu04140  Autophagy - animal
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04210  Apoptosis
tmu04218  Cellular senescence
tmu04261  Adrenergic signaling in cardiomyocytes
tmu04270  Vascular smooth muscle contraction
tmu04350  TGF-beta signaling pathway
tmu04360  Axon guidance
tmu04370  VEGF signaling pathway
tmu04371  Apelin signaling pathway
tmu04380  Osteoclast differentiation
tmu04510  Focal adhesion
tmu04520  Adherens junction
tmu04540  Gap junction
tmu04550  Signaling pathways regulating pluripotency of stem cells
tmu04611  Platelet activation
tmu04620  Toll-like receptor signaling pathway
tmu04621  NOD-like receptor signaling pathway
tmu04625  C-type lectin receptor signaling pathway
tmu04650  Natural killer cell mediated cytotoxicity
tmu04657  IL-17 signaling pathway
tmu04658  Th1 and Th2 cell differentiation
tmu04659  Th17 cell differentiation
tmu04660  T cell receptor signaling pathway
tmu04662  B cell receptor signaling pathway
tmu04664  Fc epsilon RI signaling pathway
tmu04666  Fc gamma R-mediated phagocytosis
tmu04668  TNF signaling pathway
tmu04713  Circadian entrainment
tmu04720  Long-term potentiation
tmu04722  Neurotrophin signaling pathway
tmu04723  Retrograde endocannabinoid signaling
tmu04724  Glutamatergic synapse
tmu04725  Cholinergic synapse
tmu04726  Serotonergic synapse
tmu04730  Long-term depression
tmu04810  Regulation of actin cytoskeleton
tmu04910  Insulin signaling pathway
tmu04912  GnRH signaling pathway
tmu04914  Progesterone-mediated oocyte maturation
tmu04915  Estrogen signaling pathway
tmu04916  Melanogenesis
tmu04917  Prolactin signaling pathway
tmu04919  Thyroid hormone signaling pathway
tmu04921  Oxytocin signaling pathway
tmu04926  Relaxin signaling pathway
tmu04928  Parathyroid hormone synthesis, secretion and action
tmu04929  GnRH secretion
tmu04930  Type II diabetes mellitus
tmu04933  AGE-RAGE signaling pathway in diabetic complications
tmu04934  Cushing syndrome
tmu04935  Growth hormone synthesis, secretion and action
tmu04960  Aldosterone-regulated sodium reabsorption
tmu05010  Alzheimer disease
tmu05020  Prion disease
tmu05022  Pathways of neurodegeneration - multiple diseases
tmu05034  Alcoholism
tmu05132  Salmonella infection
tmu05133  Pertussis
tmu05135  Yersinia infection
tmu05140  Leishmaniasis
tmu05142  Chagas disease
tmu05145  Toxoplasmosis
tmu05152  Tuberculosis
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05163  Human cytomegalovirus infection
tmu05164  Influenza A
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05171  Coronavirus disease - COVID-19
tmu05200  Pathways in cancer
tmu05203  Viral carcinogenesis
tmu05205  Proteoglycans in cancer
tmu05206  MicroRNAs in cancer
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05212  Pancreatic cancer
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05216  Thyroid cancer
tmu05218  Melanoma
tmu05219  Bladder cancer
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05230  Central carbon metabolism in cancer
tmu05231  Choline metabolism in cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101340589
   04012 ErbB signaling pathway
    101340589
   04014 Ras signaling pathway
    101340589
   04015 Rap1 signaling pathway
    101340589
   04350 TGF-beta signaling pathway
    101340589
   04370 VEGF signaling pathway
    101340589
   04371 Apelin signaling pathway
    101340589
   04668 TNF signaling pathway
    101340589
   04066 HIF-1 signaling pathway
    101340589
   04068 FoxO signaling pathway
    101340589
   04072 Phospholipase D signaling pathway
    101340589
   04071 Sphingolipid signaling pathway
    101340589
   04024 cAMP signaling pathway
    101340589
   04022 cGMP-PKG signaling pathway
    101340589
   04151 PI3K-Akt signaling pathway
    101340589
   04150 mTOR signaling pathway
    101340589
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101340589
  09143 Cell growth and death
   04114 Oocyte meiosis
    101340589
   04210 Apoptosis
    101340589
   04218 Cellular senescence
    101340589
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101340589
   04520 Adherens junction
    101340589
   04540 Gap junction
    101340589
   04550 Signaling pathways regulating pluripotency of stem cells
    101340589
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101340589
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101340589
   04620 Toll-like receptor signaling pathway
    101340589
   04621 NOD-like receptor signaling pathway
    101340589
   04625 C-type lectin receptor signaling pathway
    101340589
   04650 Natural killer cell mediated cytotoxicity
    101340589
   04660 T cell receptor signaling pathway
    101340589
   04658 Th1 and Th2 cell differentiation
    101340589
   04659 Th17 cell differentiation
    101340589
   04657 IL-17 signaling pathway
    101340589
   04662 B cell receptor signaling pathway
    101340589
   04664 Fc epsilon RI signaling pathway
    101340589
   04666 Fc gamma R-mediated phagocytosis
    101340589
   04062 Chemokine signaling pathway
    101340589
  09152 Endocrine system
   04910 Insulin signaling pathway
    101340589
   04929 GnRH secretion
    101340589
   04912 GnRH signaling pathway
    101340589
   04915 Estrogen signaling pathway
    101340589
   04914 Progesterone-mediated oocyte maturation
    101340589
   04917 Prolactin signaling pathway
    101340589
   04921 Oxytocin signaling pathway
    101340589
   04926 Relaxin signaling pathway
    101340589
   04935 Growth hormone synthesis, secretion and action
    101340589
   04919 Thyroid hormone signaling pathway
    101340589
   04928 Parathyroid hormone synthesis, secretion and action
    101340589
   04916 Melanogenesis
    101340589
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101340589
   04270 Vascular smooth muscle contraction
    101340589
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101340589
  09156 Nervous system
   04724 Glutamatergic synapse
    101340589
   04725 Cholinergic synapse
    101340589
   04726 Serotonergic synapse
    101340589
   04720 Long-term potentiation
    101340589
   04730 Long-term depression
    101340589
   04723 Retrograde endocannabinoid signaling
    101340589
   04722 Neurotrophin signaling pathway
    101340589
  09158 Development and regeneration
   04360 Axon guidance
    101340589
   04380 Osteoclast differentiation
    101340589
  09159 Environmental adaptation
   04713 Circadian entrainment
    101340589
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101340589
   05206 MicroRNAs in cancer
    101340589
   05205 Proteoglycans in cancer
    101340589
   05203 Viral carcinogenesis
    101340589
   05230 Central carbon metabolism in cancer
    101340589
   05231 Choline metabolism in cancer
    101340589
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101340589
  09162 Cancer: specific types
   05210 Colorectal cancer
    101340589
   05212 Pancreatic cancer
    101340589
   05225 Hepatocellular carcinoma
    101340589
   05226 Gastric cancer
    101340589
   05214 Glioma
    101340589
   05216 Thyroid cancer
    101340589
   05221 Acute myeloid leukemia
    101340589
   05220 Chronic myeloid leukemia
    101340589
   05218 Melanoma
    101340589
   05211 Renal cell carcinoma
    101340589
   05219 Bladder cancer
    101340589
   05215 Prostate cancer
    101340589
   05213 Endometrial cancer
    101340589
   05224 Breast cancer
    101340589
   05223 Non-small cell lung cancer
    101340589
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101340589
   05020 Prion disease
    101340589
   05022 Pathways of neurodegeneration - multiple diseases
    101340589
  09165 Substance dependence
   05034 Alcoholism
    101340589
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101340589
   04933 AGE-RAGE signaling pathway in diabetic complications
    101340589
   04934 Cushing syndrome
    101340589
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101340589
   05135 Yersinia infection
    101340589
   05133 Pertussis
    101340589
   05152 Tuberculosis
    101340589
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101340589
   05170 Human immunodeficiency virus 1 infection
    101340589
   05161 Hepatitis B
    101340589
   05160 Hepatitis C
    101340589
   05171 Coronavirus disease - COVID-19
    101340589
   05164 Influenza A
    101340589
   05163 Human cytomegalovirus infection
    101340589
   05167 Kaposi sarcoma-associated herpesvirus infection
    101340589
   05165 Human papillomavirus infection
    101340589
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101340589
   05140 Leishmaniasis
    101340589
   05142 Chagas disease
    101340589
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101340589
   01524 Platinum drug resistance
    101340589
   01522 Endocrine resistance
    101340589
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101340589
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tmu03036]
    101340589
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tmu04147]
    101340589
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101340589
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101340589
Chromosome and associated proteins [BR:tmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101340589
Exosome [BR:tmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101340589
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Choline_kinase Kdo FTA2
Other DBs
NCBI-GeneID: 101340589
NCBI-ProteinID: XP_004386681
UniProt: A0A2Y9E433
LinkDB
Position
Unknown
AA seq 377 aa
MAAAATEGGGEPRGADGVCLGVPGEVEIVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDH
VRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYIVQ
DLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKI
CDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNR
PIFPGKHYLDQLNHILSILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDPK
ALELLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERLKA
LIFQETARFQPGVLEAS
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcggcggcggcgactgaggggggcggggagccccggggagctgatggggtctgcctg
ggggtcccgggggaagtggagatagtaaaggggcagccattcgacgtgggccctcgctac
acgcagctgcagtacatcggcgagggcgcgtacggcatggtcagttcagcttatgaccac
gtgcgcaagactcgtgtggccatcaagaagatcagcccctttgagcatcagacctactgc
cagcgcacactgcgggagatccagatcttgctgcgcttccgccacgagaatgtcattggc
atccgagacattctgcgggcacccaccctggaagccatgagggatgtctacattgtacag
gacctgatggagacagacctgtacaagttgctcaaaagccagcagctaagcaatgaccac
gtctgctacttcctctaccagatcctgcggggcctcaaatatatccactcagccaacgtg
ctgcaccgagacctaaagccctccaacctgctcatcaacaccacctgtgaccttaagatc
tgtgatttcggcctggcccgaatcgccgatcctgagcacgaccacacaggcttcttgaca
gagtacgtggctacacgctggtaccgggcaccagagatcatgctcaactccaagggctac
accaagtccatcgacatctggtctgtgggttgcatcctggctgagatgctctccaaccgg
cccatcttccccggcaagcactacctggaccagctcaaccacattctgagtattctgggc
tccccatcccaggaggacctgaattgtattatcaacatgaaggcccgaaactacctgcag
tccctgccctccaagaccaaggtggcctgggccaagctctttcccaagtcagaccccaaa
gcccttgaactgctagaccggatgttgacctttaaccccaacaaacggatcacagtggag
gaagcactggcccacccctacctggaacagtactatgaccccacggatgagccagtggcc
gaggagcccttcacctttgacatggagctggatgatctacccaaggagcggctgaaggcg
ctcatcttccaggagacagcccgcttccagcctggggtactagaagcctcttaa

KEGG   Trichechus manatus latirostris (Florida manatee): 101358526
Entry
101358526         CDS       T05135                                 

Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu01522  Endocrine resistance
tmu01524  Platinum drug resistance
tmu04010  MAPK signaling pathway
tmu04012  ErbB signaling pathway
tmu04014  Ras signaling pathway
tmu04015  Rap1 signaling pathway
tmu04022  cGMP-PKG signaling pathway
tmu04024  cAMP signaling pathway
tmu04062  Chemokine signaling pathway
tmu04066  HIF-1 signaling pathway
tmu04068  FoxO signaling pathway
tmu04071  Sphingolipid signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04114  Oocyte meiosis
tmu04140  Autophagy - animal
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04210  Apoptosis
tmu04218  Cellular senescence
tmu04261  Adrenergic signaling in cardiomyocytes
tmu04270  Vascular smooth muscle contraction
tmu04350  TGF-beta signaling pathway
tmu04360  Axon guidance
tmu04370  VEGF signaling pathway
tmu04371  Apelin signaling pathway
tmu04380  Osteoclast differentiation
tmu04510  Focal adhesion
tmu04520  Adherens junction
tmu04540  Gap junction
tmu04550  Signaling pathways regulating pluripotency of stem cells
tmu04611  Platelet activation
tmu04620  Toll-like receptor signaling pathway
tmu04621  NOD-like receptor signaling pathway
tmu04625  C-type lectin receptor signaling pathway
tmu04650  Natural killer cell mediated cytotoxicity
tmu04657  IL-17 signaling pathway
tmu04658  Th1 and Th2 cell differentiation
tmu04659  Th17 cell differentiation
tmu04660  T cell receptor signaling pathway
tmu04662  B cell receptor signaling pathway
tmu04664  Fc epsilon RI signaling pathway
tmu04666  Fc gamma R-mediated phagocytosis
tmu04668  TNF signaling pathway
tmu04713  Circadian entrainment
tmu04720  Long-term potentiation
tmu04722  Neurotrophin signaling pathway
tmu04723  Retrograde endocannabinoid signaling
tmu04724  Glutamatergic synapse
tmu04725  Cholinergic synapse
tmu04726  Serotonergic synapse
tmu04730  Long-term depression
tmu04810  Regulation of actin cytoskeleton
tmu04910  Insulin signaling pathway
tmu04912  GnRH signaling pathway
tmu04914  Progesterone-mediated oocyte maturation
tmu04915  Estrogen signaling pathway
tmu04916  Melanogenesis
tmu04917  Prolactin signaling pathway
tmu04919  Thyroid hormone signaling pathway
tmu04921  Oxytocin signaling pathway
tmu04926  Relaxin signaling pathway
tmu04928  Parathyroid hormone synthesis, secretion and action
tmu04929  GnRH secretion
tmu04930  Type II diabetes mellitus
tmu04933  AGE-RAGE signaling pathway in diabetic complications
tmu04934  Cushing syndrome
tmu04935  Growth hormone synthesis, secretion and action
tmu04960  Aldosterone-regulated sodium reabsorption
tmu05010  Alzheimer disease
tmu05020  Prion disease
tmu05022  Pathways of neurodegeneration - multiple diseases
tmu05034  Alcoholism
tmu05132  Salmonella infection
tmu05133  Pertussis
tmu05135  Yersinia infection
tmu05140  Leishmaniasis
tmu05142  Chagas disease
tmu05145  Toxoplasmosis
tmu05152  Tuberculosis
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05163  Human cytomegalovirus infection
tmu05164  Influenza A
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05171  Coronavirus disease - COVID-19
tmu05200  Pathways in cancer
tmu05203  Viral carcinogenesis
tmu05205  Proteoglycans in cancer
tmu05206  MicroRNAs in cancer
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05212  Pancreatic cancer
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05216  Thyroid cancer
tmu05218  Melanoma
tmu05219  Bladder cancer
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05230  Central carbon metabolism in cancer
tmu05231  Choline metabolism in cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101358526
   04012 ErbB signaling pathway
    101358526
   04014 Ras signaling pathway
    101358526
   04015 Rap1 signaling pathway
    101358526
   04350 TGF-beta signaling pathway
    101358526
   04370 VEGF signaling pathway
    101358526
   04371 Apelin signaling pathway
    101358526
   04668 TNF signaling pathway
    101358526
   04066 HIF-1 signaling pathway
    101358526
   04068 FoxO signaling pathway
    101358526
   04072 Phospholipase D signaling pathway
    101358526
   04071 Sphingolipid signaling pathway
    101358526
   04024 cAMP signaling pathway
    101358526
   04022 cGMP-PKG signaling pathway
    101358526
   04151 PI3K-Akt signaling pathway
    101358526
   04150 mTOR signaling pathway
    101358526
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101358526
  09143 Cell growth and death
   04114 Oocyte meiosis
    101358526
   04210 Apoptosis
    101358526
   04218 Cellular senescence
    101358526
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101358526
   04520 Adherens junction
    101358526
   04540 Gap junction
    101358526
   04550 Signaling pathways regulating pluripotency of stem cells
    101358526
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101358526
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101358526
   04620 Toll-like receptor signaling pathway
    101358526
   04621 NOD-like receptor signaling pathway
    101358526
   04625 C-type lectin receptor signaling pathway
    101358526
   04650 Natural killer cell mediated cytotoxicity
    101358526
   04660 T cell receptor signaling pathway
    101358526
   04658 Th1 and Th2 cell differentiation
    101358526
   04659 Th17 cell differentiation
    101358526
   04657 IL-17 signaling pathway
    101358526
   04662 B cell receptor signaling pathway
    101358526
   04664 Fc epsilon RI signaling pathway
    101358526
   04666 Fc gamma R-mediated phagocytosis
    101358526
   04062 Chemokine signaling pathway
    101358526
  09152 Endocrine system
   04910 Insulin signaling pathway
    101358526
   04929 GnRH secretion
    101358526
   04912 GnRH signaling pathway
    101358526
   04915 Estrogen signaling pathway
    101358526
   04914 Progesterone-mediated oocyte maturation
    101358526
   04917 Prolactin signaling pathway
    101358526
   04921 Oxytocin signaling pathway
    101358526
   04926 Relaxin signaling pathway
    101358526
   04935 Growth hormone synthesis, secretion and action
    101358526
   04919 Thyroid hormone signaling pathway
    101358526
   04928 Parathyroid hormone synthesis, secretion and action
    101358526
   04916 Melanogenesis
    101358526
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101358526
   04270 Vascular smooth muscle contraction
    101358526
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101358526
  09156 Nervous system
   04724 Glutamatergic synapse
    101358526
   04725 Cholinergic synapse
    101358526
   04726 Serotonergic synapse
    101358526
   04720 Long-term potentiation
    101358526
   04730 Long-term depression
    101358526
   04723 Retrograde endocannabinoid signaling
    101358526
   04722 Neurotrophin signaling pathway
    101358526
  09158 Development and regeneration
   04360 Axon guidance
    101358526
   04380 Osteoclast differentiation
    101358526
  09159 Environmental adaptation
   04713 Circadian entrainment
    101358526
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101358526
   05206 MicroRNAs in cancer
    101358526
   05205 Proteoglycans in cancer
    101358526
   05203 Viral carcinogenesis
    101358526
   05230 Central carbon metabolism in cancer
    101358526
   05231 Choline metabolism in cancer
    101358526
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101358526
  09162 Cancer: specific types
   05210 Colorectal cancer
    101358526
   05212 Pancreatic cancer
    101358526
   05225 Hepatocellular carcinoma
    101358526
   05226 Gastric cancer
    101358526
   05214 Glioma
    101358526
   05216 Thyroid cancer
    101358526
   05221 Acute myeloid leukemia
    101358526
   05220 Chronic myeloid leukemia
    101358526
   05218 Melanoma
    101358526
   05211 Renal cell carcinoma
    101358526
   05219 Bladder cancer
    101358526
   05215 Prostate cancer
    101358526
   05213 Endometrial cancer
    101358526
   05224 Breast cancer
    101358526
   05223 Non-small cell lung cancer
    101358526
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101358526
   05020 Prion disease
    101358526
   05022 Pathways of neurodegeneration - multiple diseases
    101358526
  09165 Substance dependence
   05034 Alcoholism
    101358526
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101358526
   04933 AGE-RAGE signaling pathway in diabetic complications
    101358526
   04934 Cushing syndrome
    101358526
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101358526
   05135 Yersinia infection
    101358526
   05133 Pertussis
    101358526
   05152 Tuberculosis
    101358526
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101358526
   05170 Human immunodeficiency virus 1 infection
    101358526
   05161 Hepatitis B
    101358526
   05160 Hepatitis C
    101358526
   05171 Coronavirus disease - COVID-19
    101358526
   05164 Influenza A
    101358526
   05163 Human cytomegalovirus infection
    101358526
   05167 Kaposi sarcoma-associated herpesvirus infection
    101358526
   05165 Human papillomavirus infection
    101358526
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101358526
   05140 Leishmaniasis
    101358526
   05142 Chagas disease
    101358526
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101358526
   01524 Platinum drug resistance
    101358526
   01522 Endocrine resistance
    101358526
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101358526
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tmu03036]
    101358526
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tmu04147]
    101358526
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101358526
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101358526
Chromosome and associated proteins [BR:tmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101358526
Exosome [BR:tmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101358526
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Choline_kinase FTA2 Kdo Kinase-like
Other DBs
NCBI-GeneID: 101358526
NCBI-ProteinID: XP_004386255
UniProt: A0A2Y9RRM5
LinkDB
Position
Unknown
AA seq 263 aa
MKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLL
NTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCI
LAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNR
LFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDD
LPKEKLKELIFEETARFQPGYRS
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaaggatgtatatatagtacaggacctcatggaaacagacctttacaagctcttgaag
acgcaacacctcagcaacgaccatatctgctattttctttaccagatcctcagagggtta
aaatatatccattcagctaatgttctgcaccgtgacctcaaaccttccaacctgctgctc
aacaccacctgtgatctcaagatctgcgacttcggcttggcccgcgttgctgacccggac
catgaccacacaggcttcctgacggagtatgtagccacacgctggtacagggctccagaa
attatgttgaattccaagggctacactaagtccattgatatctggtctgttggctgcatt
ctggcagagatgctctccaacaggcccatcttccccggaaagcactatcttgaccagctg
aaccacattctaggtattcttggatccccatcacaagaagacctgaattgtataataaat
ttaaaagctagaaactatttgctttctcttccacacaaaaataaggtgccatggaacagg
ctgttcccaaatgctgattccaaagctctggacttactggataagatgttgactttcaac
ccacacaagaggattgaagtagaacaggctctggcccacccatatctggagcagtattac
gacccaagtgatgagcctattgctgaagcaccattcaagtttgacatggaattggatgat
ttgcccaaggaaaaactcaaagaactcatttttgaagagactgcaagattccagccagga
tacagatcttaa

DBGET integrated database retrieval system