KEGG   Trichechus manatus latirostris (Florida manatee): 101340888Help
Entry
101340888         CDS       T05135                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: microsomal glutathione S-transferase 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00480  Glutathione metabolism
tmu00980  Metabolism of xenobiotics by cytochrome P450
tmu00982  Drug metabolism - cytochrome P450
tmu00983  Drug metabolism - other enzymes
tmu01524  Platinum drug resistance
tmu05200  Pathways in cancer
tmu05204  Chemical carcinogenesis
tmu05225  Hepatocellular carcinoma
tmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101340888
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101340888
   00982 Drug metabolism - cytochrome P450
    101340888
   00983 Drug metabolism - other enzymes
    101340888
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    101340888
   05204 Chemical carcinogenesis
    101340888
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    101340888
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101340888
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    101340888
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tmu02000]
    101340888
Enzymes [BR:tmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101340888
Transporters [BR:tmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   101340888
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 101340888
NCBI-ProteinID: XP_004390873
UniProt: A0A2Y9EBG3
LinkDB All DBs
Position
Unknown
AA seq 155 aa AA seqDB search
MIDLTQLTKNEVLMAFSSYAPLVLSKMMFMSFATAFYRLTRKAFANPEDCAHHGKGENAK
KYLRTDDRVECVXRAHLNDLENIVSFVGIGLLYSLSGPDLSTALLHFRLFVGARIYHTIA
YLIPLPXPNRAFAFFVGYGVTFSMAYSLLRDRLYL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgattgacctcacccaactaaccaagaatgaagtactcatggccttttcctcctatgca
ccacttgttctttcaaaaatgatgtttatgagttttgccactgcattctatagactgaca
agaaaggcttttgccaacccagaagactgtgcacatcatggcaaaggagaaaatgccaag
aagtatcttcgaacagatgacagagtggaatgtgtatgaagagcccacctgaatgacctt
gaaaatattgtgtcatttgttggcattggccttctgtattccttgagtggtccagatctc
tctacagccctcctgcacttcagactttttgttggagcacggatctaccacacaattgca
tatctgataccccttcccnagccaaatcgagcttttgctttttttgttggatatggagtt
acattttcaatggcttatagtttgctgagagatagattgtacctataa

DBGET integrated database retrieval system