KEGG   Trichechus manatus latirostris (Florida manatee): 101340976
Entry
101340976         CDS       T05135                                 

Definition
(RefSeq) retinoic acid receptor alpha isoform X3
  KO
K08527  retinoic acid receptor alpha
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04659  Th17 cell differentiation
tmu04915  Estrogen signaling pathway
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101340976
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101340976
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101340976
   05202 Transcriptional misregulation in cancer
    101340976
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101340976
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tmu03000]
    101340976
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:tmu03310]
    101340976
Transcription factors [BR:tmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    101340976
Nuclear receptors [BR:tmu03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   101340976
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 101340976
NCBI-ProteinID: XP_004378129
UniProt: A0A2Y9DNT4
LinkDB
Position
Unknown
AA seq 461 aa
MYESVEVAGLTPSPNPFLVVDFYNQNRACLLPEKGLPAPGPYSTPLRTPLWNGSNHSIET
QSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYT
CHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPE
VGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFA
KQLPGFTTLTIADQITLLKGACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFG
PLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYV
RKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTL
SGQPGGRGRDRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacgagagtgtggaagtggcggggctcaccccttcccctaatcccttcctagtggtg
gatttttataaccagaaccgggcctgtttgctcccggaaaaggggctccccgcccccggc
ccctactccaccccgctccggactccgctttggaatggctcaaaccactccattgagacc
cagagcagcagttctgaagagatagtgcccagccctccctcaccgccccctcttcctcgc
atctacaagccttgctttgtctgtcaagacaagtcctcaggctaccactatggggtcagc
gcctgtgagggctgcaagggcttcttccgccgcagcatccagaagaacatggtgtacacg
tgtcaccgggacaagaactgcatcatcaacaaggtgacccggaaccgctgccagtactgc
cggctgcagaaatgctttgaagtgggcatgtccaaagagtctgtgaggaacgaccgaaac
aagaagaagaaggaggtgcccaagccagagtgctccgagagctacacgctgacaccggag
gtgggggagctcattgagaaggtgcgcaaggcgcaccaggaaaccttccctgccctctgc
cagctgggcaaatacactacgaacaacagctcagaacaacgtgtctctctggacattgac
ctctgggacaagttcagtgaactctccaccaagtgcatcattaagactgtggagttcgcc
aagcagctgcccggcttcaccaccctcaccattgccgaccagatcaccctcctcaagggt
gcctgcctggacatcctgattctgcggatctgcacgcggtacacacccgagcaggacaca
atgaccttctcggatgggctgaccctgaatcggacccagatgcacaatgctggcttcggc
ccccttaccgacctggtcttcgccttcgccaaccagctgctgcccctggagatggatgat
gccgagacagggctgctcagcgccatttgcctcatctgtggagatcggcaggacctggag
cagccagacagggtggacatgctgcaggagccactgctggaggcactgaaggtctatgtg
cggaaacggaggcccagccgcccccatatgttccccaagatgctgatgaagatcacagac
ctgcgaagcatcagtgctaagggggctgagcgggtgatcacgctgaagatggagatccca
ggctccatgccacctctcatccaggaaatgctggagaactcagagggcctggacacgctg
agtggacagccggggggcaggggacgggaccgggatgggggcggcctggcccccccgcca
ggcagctgtagccccagcctcagccccagctcaaacagaagcagcccggccacccactcc
ccatga

KEGG   Trichechus manatus latirostris (Florida manatee): 101350829
Entry
101350829         CDS       T05135                                 

Definition
(RefSeq) zinc finger and BTB domain-containing protein 16
  KO
K10055  zinc finger and BTB domain-containing protein 16
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101350829
   05202 Transcriptional misregulation in cancer
    101350829
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101350829
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tmu03000]
    101350829
   04121 Ubiquitin system [BR:tmu04121]
    101350829
Transcription factors [BR:tmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    101350829
Ubiquitin system [BR:tmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     101350829
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2_4 zf-C2H2 BTB zf-C2H2_6 zf-C2H2_jaz zf-met zf_UBZ zf-C2H2_2 Endonuclease_7 zinc_ribbon_15
Other DBs
NCBI-GeneID: 101350829
NCBI-ProteinID: XP_004382576
UniProt: A0A2Y9DWQ0
LinkDB
Position
Unknown
AA seq 673 aa
MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE
ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK
ILETIQASDDNDNEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPM
VDQSPSVSTSFGLSALSPTKAAVDSLMTIGQSLLQGTVQPPAGPDDPTLAGGGRHPGVAE
VKTEMMQVDEVPSQDSPGAAESSISGGIGDKTEERVKEGPGTPTRSSVITSARELHYGRE
ESAEQLPPSAEAGQGPLGRPEHPGPPAEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQP
TLAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESRAMGEQCSVCGVELPDNEAVE
QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR
QTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSH
TGDHPYECEYCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEK
PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPD
WRIEKTYLYLCYV
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggatctgacgaagatgggcatgatccagctgcagaaccccagccaccccacagggctt
ctgtgcaaggccaaccagatgcgactggccgggaccctgtgtgatgtggtcatcatggtg
gacagccaggagtttcatgcccaccggacggtgctggcctgcaccagcaagatgtttgag
atcctcttccaccgcaatagccagcactatactctggacttcctctcgccaaagaccttc
cagcagattctggaatatgcatacacggccacgctgcaagccaaggcggaggacctggat
gacctgctgtatgcagccgagatcctagagatagagtatctggaggagcagtgcctgaag
atcctggagaccatccaggcctcagatgacaacgacaacgaggctaccatggcggatggc
ggggctgaggaagaagaggaccgcaaggctcggtatctcaagaacatcttcatctcgaag
cattccagcgaggagagtgggtatgccagtgtggctgggcagagcctccctgggcccatg
gtggaccagagcccttcagtctccacctcctttggtctttcggccttgagccccaccaaa
gctgcagtggacagtttgatgaccataggacagtctctcctgcagggaactgtccagcct
cctgcaggacctgatgacccgactctggctgggggtgggcggcaccctggggtggccgag
gtgaagacggagatgatgcaggtggatgaggtgcccagccaggacagccctggggcagcc
gagtctagcatctcaggtgggataggggacaagaccgaggaaagggtcaaagaggggcct
gggaccccgactcggagcagtgtcattactagtgccagggagctgcactacgggcgagag
gagagtgctgaacagctgccgccttcagctgaggctggccagggcccccttggccgacca
gagcaccctggacccccagctgagaaacatctgggcatctactccgtgttgcccaaccac
aaggctgatgcagtgttgagcatgccatcctcagtgacctctgggctccacgtgcagcct
accctggctgtctccatggacttcagcacctatggggggctgctgccccagggcttcatc
cagagagagctgttcagcaagctgggcgagctggctgtaggcatgaagtcggagagccga
gccatgggcgagcagtgcagcgtgtgtggggtcgagcttcctgataacgaggctgtggag
cagcacaggaagctgcacagtgggatgaagacatacgggtgtgagctctgcggaaagcgc
ttcctggatagtttgcgactgagaatgcacttactggctcattcagcgggtgccaaagcc
tttgtctgtgaccaatgcggtgcccagttttcaaaggaggatgcactggagacacacagg
cagacccataccggcacagacatggctgtcttctgtctgctgtgcgggaagcgtttccag
gcgcagagtgcgctccagcagcacatggaggtccacgcaggcgtgcgcagctacatctgc
agtgagtgcaaccgcactttccccagccacacggccctcaaacgccacctgcgctcgcac
acaggcgaccacccgtatgagtgtgagtactgtggcagctgcttccgggacgagagcaca
ctcaagagccacaaacgcatccacacgggggagaaaccctatgagtgcaatggctgtggc
aagaagttcagcctgaagcaccagctggagacgcactatagggtgcacacaggtgagaag
ccctttgaatgtaagctgtgccaccagcgctcccgggactactcggccatgatcaagcac
ctgagaacgcacaatggcgcctcgccctaccagtgcaccatctgcacggagtactgccct
agcctctcctccatgcagaagcacatgaagggccacaagcccgaggagatcccgcccgac
tggaggatagagaagacttacctctacctgtgctacgtgtga

DBGET integrated database retrieval system