KEGG   Trichechus manatus latirostris (Florida manatee): 101340976
Entry
101340976         CDS       T05135                                 

Definition
(RefSeq) retinoic acid receptor alpha isoform X3
  KO
K08527  retinoic acid receptor alpha
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04659  Th17 cell differentiation
tmu04915  Estrogen signaling pathway
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101340976
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101340976
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101340976
   05202 Transcriptional misregulation in cancer
    101340976
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101340976
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tmu03000]
    101340976
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:tmu03310]
    101340976
Transcription factors [BR:tmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    101340976
Nuclear receptors [BR:tmu03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   101340976
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 101340976
NCBI-ProteinID: XP_004378129
UniProt: A0A2Y9DNT4
LinkDB
Position
Unknown
AA seq 461 aa
MYESVEVAGLTPSPNPFLVVDFYNQNRACLLPEKGLPAPGPYSTPLRTPLWNGSNHSIET
QSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYT
CHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPE
VGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFA
KQLPGFTTLTIADQITLLKGACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFG
PLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYV
RKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTL
SGQPGGRGRDRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacgagagtgtggaagtggcggggctcaccccttcccctaatcccttcctagtggtg
gatttttataaccagaaccgggcctgtttgctcccggaaaaggggctccccgcccccggc
ccctactccaccccgctccggactccgctttggaatggctcaaaccactccattgagacc
cagagcagcagttctgaagagatagtgcccagccctccctcaccgccccctcttcctcgc
atctacaagccttgctttgtctgtcaagacaagtcctcaggctaccactatggggtcagc
gcctgtgagggctgcaagggcttcttccgccgcagcatccagaagaacatggtgtacacg
tgtcaccgggacaagaactgcatcatcaacaaggtgacccggaaccgctgccagtactgc
cggctgcagaaatgctttgaagtgggcatgtccaaagagtctgtgaggaacgaccgaaac
aagaagaagaaggaggtgcccaagccagagtgctccgagagctacacgctgacaccggag
gtgggggagctcattgagaaggtgcgcaaggcgcaccaggaaaccttccctgccctctgc
cagctgggcaaatacactacgaacaacagctcagaacaacgtgtctctctggacattgac
ctctgggacaagttcagtgaactctccaccaagtgcatcattaagactgtggagttcgcc
aagcagctgcccggcttcaccaccctcaccattgccgaccagatcaccctcctcaagggt
gcctgcctggacatcctgattctgcggatctgcacgcggtacacacccgagcaggacaca
atgaccttctcggatgggctgaccctgaatcggacccagatgcacaatgctggcttcggc
ccccttaccgacctggtcttcgccttcgccaaccagctgctgcccctggagatggatgat
gccgagacagggctgctcagcgccatttgcctcatctgtggagatcggcaggacctggag
cagccagacagggtggacatgctgcaggagccactgctggaggcactgaaggtctatgtg
cggaaacggaggcccagccgcccccatatgttccccaagatgctgatgaagatcacagac
ctgcgaagcatcagtgctaagggggctgagcgggtgatcacgctgaagatggagatccca
ggctccatgccacctctcatccaggaaatgctggagaactcagagggcctggacacgctg
agtggacagccggggggcaggggacgggaccgggatgggggcggcctggcccccccgcca
ggcagctgtagccccagcctcagccccagctcaaacagaagcagcccggccacccactcc
ccatga

KEGG   Trichechus manatus latirostris (Florida manatee): 101356208
Entry
101356208         CDS       T05135                                 

Definition
(RefSeq) protein PML isoform X1
  KO
K10054  probable transcription factor PML
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04120  Ubiquitin mediated proteolysis
tmu04144  Endocytosis
tmu05164  Influenza A
tmu05168  Herpes simplex virus 1 infection
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101356208
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101356208
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101356208
   05202 Transcriptional misregulation in cancer
    101356208
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101356208
  09172 Infectious disease: viral
   05164 Influenza A
    101356208
   05168 Herpes simplex virus 1 infection
    101356208
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:tmu04121]
    101356208
Ubiquitin system [BR:tmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    101356208
SSDB
Motif
Pfam: DUF3583 zf-B_box
Other DBs
NCBI-GeneID: 101356208
NCBI-ProteinID: XP_004374794
UniProt: A0A2Y9DHP6
LinkDB
Position
Unknown
AA seq 854 aa
MPPPESPFEDHQPSPSPSPSPSPSPTEEEFQFLCCQCCKAEAKCPKLLPCLHTLCSGCLE
AAGVHCPICQAPRSPGADAQALDNVFFESLQRRLSMYREIVSLHAACTRCKEPADFWCFE
CEQLICTKCFEAHQWFVKHEARPLASLRSQSVHEFLDGSRKSNNIFCSNSKHHTPELTSI
YCRGCSKPLCCSCALLDTGHSELKCDIRAEIQQRQEELDTMTQALQEQDGVFGAAHAQMR
SAIGQLDRARADTEELIRARVRQVVAHVQMQEHKLIQSLKARYQSESEEMTRRLSRLDAV
LQRIRTGGALVQRMKRYASDQEVLDMHSFLREALHRLRQEEPQSLQAPVPTNSFDEFKVR
LRDLVSCITQGTDAALPRRASPEAASTPRNSFDVDLPEEAQRAQAQVMGLSEAQPMAVVQ
QEPGAHPVPMYAFSIKDPSYREEAPSPLTPQKRKSCQTEGPRKIIKLESEEEKEERLARS
SPEQPRPSTSKAVSPPHLDEPPSLGSPDTGNKVLLLNNNHVTSEPGEEAEERVVVISSSE
DSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDESLADPQAEDRPLVFFDLRIDNETQK
ISQLAAVNRESKFRVLIQPKAFFSIYSKAVSLEVGLRHFLRFLGSMRRPILACYKLWGPS
LPYFFQALEDMNSLWEFQEAISGFLATLPLIRECVPGASSFKLKSLAKTYLARNVNDHSA
LASVLAMRDLCHLLEVFPGPSLAQHVYSFSDLQCFASLQPLVRAAVLPRANARLLALHNV
SFVELLAAHRCDPKWGLKKYSRYLSLQAAPALPAQPALDLQALSAYFATLLAQGEGISAP
PSGHSLVERASQQN
NT seq 2565 nt   +upstreamnt  +downstreamnt
atgccgccgccggagtcccccttcgaggaccaccagcccagccccagccccagccccagc
cccagccccagccccacggaggaggaattccagttcctgtgctgccagtgctgcaaggcc
gaagccaagtgccccaagttgctgccttgtctgcacacactgtgctcaggatgcctggag
gcagcgggcgtgcactgccccatctgccaggcacccaggtccccgggtgctgatgcgcag
gccctggataacgttttcttcgagagtctgcagcggcgcctgtcgatgtaccgggagatt
gtgagcctccatgcggcctgcacccgctgcaaagagcctgcggacttctggtgcttcgag
tgtgagcagctcatctgcaccaagtgctttgaggcgcaccagtggtttgttaagcacgag
gcccgacccctggccagtctccgaagccagtcggtgcacgagttcctggacggctcacgc
aagtccaacaacatcttctgctccaactccaagcaccacacccctgagctgacaagcatc
tactgccgaggctgctccaaacccctgtgctgctcgtgtgcactcctggacacaggccat
agcgagctcaaatgcgacatccgtgcagagatccagcagcggcaggaggagctggacacc
atgacgcaggcgctgcaggagcaggacggagtcttcggtgcggcgcacgcgcagatgcgc
tcggccatcggccagttagaccgcgcgcgcgctgacaccgaggaactgattcgagcgcgc
gtgcgccaggtcgtagcgcacgtgcagatgcaggagcacaaactgatccagagcctgaag
gcgcggtaccagagtgaatccgaagagatgacccgccgcctgagccgcctggacgccgtg
ctacagcgcatccgcacgggtggcgcgctcgtgcagaggatgaagcgctatgcctcggac
caggaggtgctggacatgcacagctttctgcgtgaggcgctccaccgcctgcgccaggag
gagccccagagcctgcaagcccccgtacccaccaacagctttgacgagttcaaggttcgc
ctgcgggatctggtatcttgcatcacccagggcacagatgcagctctacccaggagagcc
agcccagaggctgccagcactcccaggaactcttttgacgttgatctgccagaggaggca
cagagggctcaggcgcaggtcatggggctgagtgaggcccagccgatggctgtggtacag
caagagcccggggcacaccctgtgcccatgtatgcgttctccatcaaagacccctcctat
cgagaggaggcccccagcccactcacaccccaaaagaggaaatcctgccagaccgagggc
cccaggaaaatcatcaagttggagtctgaggaggagaaggaagaaaggctggcccggagc
tcccctgagcagcccaggcccagcacctccaaggcagtctcgccaccccacctggatgaa
ccccctagcctcgggagccccgacactggaaacaaggtcctcctgctcaacaacaaccat
gtgaccagcgagcctggggaggaggcagaggagcgcgtcgtggtgatcagcagctcagaa
gactcagatgcagaaaattcgtcctcccgagagctggatgatagcagcagcgagtccagt
gacctccagctggagggccccagcaccctcagggtcctggacgagagcctcgccgatccc
caagcagaagacaggcccctggttttctttgacctcaggattgacaatgaaacccagaag
attagccagctggcggccgtgaaccgggaaagcaagttccgtgtgctcatccagcccaag
gccttcttcagcatctactcaaaggctgtgtccctggaggtgggcctgcggcacttcctc
cgcttcctgggctccatgcgccgccccattctggcctgctataagctgtgggggcccagc
ctcccctacttcttccaggccctggaggacatgaacagcctgtgggaattccaggaggcc
atctcgggcttcctggccaccctgcccctgatccgggagtgtgtacccggggccagcagc
ttcaaactcaagagcctggccaagacctacctggcaagaaacgtgaacgaccacagtgcc
ctggcctccgtgctcgccatgcgcgacctgtgccacctccttgaggtcttcccaggcccc
tcgctggcccagcatgtctactctttcagcgacctgcagtgctttgcgtccctgcagccc
ctggtgcgagcggctgtcctgccccgggccaacgcccgccttctggccctgcacaatgtg
agctttgtggagctgctggctgcccaccgctgtgacccgaagtggggcttaaagaagtat
agccggtacctgagcctgcaggccgctcctgcactgcccgcccagcctgctctggacctg
caggctctcagcgcctactttgcaaccctgttggcacagggggagggcatctctgcccca
ccctccggccatagcttggtagaacgggcctcccagcagaactga

DBGET integrated database retrieval system