KEGG   Trichechus manatus latirostris (Florida manatee): 101341010
Entry
101341010         CDS       T05135                                 

Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04060  Cytokine-cytokine receptor interaction
tmu04151  PI3K-Akt signaling pathway
tmu04630  JAK-STAT signaling pathway
tmu04640  Hematopoietic cell lineage
tmu04657  IL-17 signaling pathway
tmu04658  Th1 and Th2 cell differentiation
tmu04659  Th17 cell differentiation
tmu04660  T cell receptor signaling pathway
tmu04664  Fc epsilon RI signaling pathway
tmu04672  Intestinal immune network for IgA production
tmu05140  Leishmaniasis
tmu05200  Pathways in cancer
tmu05310  Asthma
tmu05320  Autoimmune thyroid disease
tmu05321  Inflammatory bowel disease
tmu05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101341010
   04151 PI3K-Akt signaling pathway
    101341010
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101341010
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101341010
   04660 T cell receptor signaling pathway
    101341010
   04658 Th1 and Th2 cell differentiation
    101341010
   04659 Th17 cell differentiation
    101341010
   04657 IL-17 signaling pathway
    101341010
   04664 Fc epsilon RI signaling pathway
    101341010
   04672 Intestinal immune network for IgA production
    101341010
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101341010
  09163 Immune disease
   05310 Asthma
    101341010
   05320 Autoimmune thyroid disease
    101341010
   05321 Inflammatory bowel disease
    101341010
   05330 Allograft rejection
    101341010
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101341010
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tmu04052]
    101341010
   00536 Glycosaminoglycan binding proteins [BR:tmu00536]
    101341010
Cytokines and growth factors [BR:tmu04052]
 Cytokines
  Interleukins
   101341010
Glycosaminoglycan binding proteins [BR:tmu00536]
 Heparan sulfate / Haparin
  Cytokines
   101341010
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 101341010
NCBI-ProteinID: XP_004384825
UniProt: A0A2Y9E0J2
LinkDB
Position
Unknown
AA seq 139 aa
MGLTFQLIPTLLCLLVCTSNFVHGQKCGITLREIIKTLNFLTEKKHGCTELTVADAFAAS
KNTTEKETICRATTVLWQVYTRHKCFSKYLRGLRRSLSSMTNLTYCPVSEDRTSTLKDFL
ERLKTIMKEKYSKCGRRIF
NT seq 420 nt   +upstreamnt  +downstreamnt
atgggtctcaccttccaactgattccaactctgttgtgcctactagtatgtaccagcaac
tttgtccacggccaaaaatgtggtattaccttaagagagatcatcaaaactttgaacttc
ctcacagagaagaagcatgggtgcaccgagttgactgtagcagacgcctttgctgcctcg
aagaatacaaccgagaaagaaaccatttgcagagctacgactgtgctttggcaggtctat
acacgtcacaaatgttttagcaaatacctgagaggactcagaagaagcctcagcagcatg
acaaacctgacttactgtcctgtgagtgaagacaggacaagtacattgaaagacttcttg
gaaaggctaaagacgatcatgaaggagaaatattcaaagtgtggaagaagaatattttaa

DBGET integrated database retrieval system