KEGG   Trichechus manatus latirostris (Florida manatee): 101341078
Entry
101341078         CDS       T05135                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu01522  Endocrine resistance
tmu04010  MAPK signaling pathway
tmu04012  ErbB signaling pathway
tmu04014  Ras signaling pathway
tmu04015  Rap1 signaling pathway
tmu04022  cGMP-PKG signaling pathway
tmu04024  cAMP signaling pathway
tmu04066  HIF-1 signaling pathway
tmu04068  FoxO signaling pathway
tmu04071  Sphingolipid signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04140  Autophagy - animal
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04210  Apoptosis
tmu04218  Cellular senescence
tmu04270  Vascular smooth muscle contraction
tmu04370  VEGF signaling pathway
tmu04371  Apelin signaling pathway
tmu04540  Gap junction
tmu04550  Signaling pathways regulating pluripotency of stem cells
tmu04613  Neutrophil extracellular trap formation
tmu04620  Toll-like receptor signaling pathway
tmu04650  Natural killer cell mediated cytotoxicity
tmu04660  T cell receptor signaling pathway
tmu04662  B cell receptor signaling pathway
tmu04664  Fc epsilon RI signaling pathway
tmu04720  Long-term potentiation
tmu04722  Neurotrophin signaling pathway
tmu04730  Long-term depression
tmu04810  Regulation of actin cytoskeleton
tmu04910  Insulin signaling pathway
tmu04912  GnRH signaling pathway
tmu04915  Estrogen signaling pathway
tmu04916  Melanogenesis
tmu04917  Prolactin signaling pathway
tmu04919  Thyroid hormone signaling pathway
tmu04921  Oxytocin signaling pathway
tmu04926  Relaxin signaling pathway
tmu04929  GnRH secretion
tmu04934  Cushing syndrome
tmu04935  Growth hormone synthesis, secretion and action
tmu05010  Alzheimer disease
tmu05022  Pathways of neurodegeneration - multiple diseases
tmu05132  Salmonella infection
tmu05135  Yersinia infection
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05163  Human cytomegalovirus infection
tmu05164  Influenza A
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05200  Pathways in cancer
tmu05205  Proteoglycans in cancer
tmu05206  MicroRNAs in cancer
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05216  Thyroid cancer
tmu05218  Melanoma
tmu05219  Bladder cancer
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05230  Central carbon metabolism in cancer
tmu05231  Choline metabolism in cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101341078
   04012 ErbB signaling pathway
    101341078
   04014 Ras signaling pathway
    101341078
   04015 Rap1 signaling pathway
    101341078
   04370 VEGF signaling pathway
    101341078
   04371 Apelin signaling pathway
    101341078
   04066 HIF-1 signaling pathway
    101341078
   04068 FoxO signaling pathway
    101341078
   04072 Phospholipase D signaling pathway
    101341078
   04071 Sphingolipid signaling pathway
    101341078
   04024 cAMP signaling pathway
    101341078
   04022 cGMP-PKG signaling pathway
    101341078
   04151 PI3K-Akt signaling pathway
    101341078
   04150 mTOR signaling pathway
    101341078
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101341078
  09143 Cell growth and death
   04210 Apoptosis
    101341078
   04218 Cellular senescence
    101341078
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101341078
   04550 Signaling pathways regulating pluripotency of stem cells
    101341078
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101341078
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101341078
   04620 Toll-like receptor signaling pathway
    101341078
   04650 Natural killer cell mediated cytotoxicity
    101341078
   04660 T cell receptor signaling pathway
    101341078
   04662 B cell receptor signaling pathway
    101341078
   04664 Fc epsilon RI signaling pathway
    101341078
  09152 Endocrine system
   04910 Insulin signaling pathway
    101341078
   04929 GnRH secretion
    101341078
   04912 GnRH signaling pathway
    101341078
   04915 Estrogen signaling pathway
    101341078
   04917 Prolactin signaling pathway
    101341078
   04921 Oxytocin signaling pathway
    101341078
   04926 Relaxin signaling pathway
    101341078
   04935 Growth hormone synthesis, secretion and action
    101341078
   04919 Thyroid hormone signaling pathway
    101341078
   04916 Melanogenesis
    101341078
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101341078
  09156 Nervous system
   04720 Long-term potentiation
    101341078
   04730 Long-term depression
    101341078
   04722 Neurotrophin signaling pathway
    101341078
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101341078
   05206 MicroRNAs in cancer
    101341078
   05205 Proteoglycans in cancer
    101341078
   05230 Central carbon metabolism in cancer
    101341078
   05231 Choline metabolism in cancer
    101341078
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101341078
  09162 Cancer: specific types
   05210 Colorectal cancer
    101341078
   05225 Hepatocellular carcinoma
    101341078
   05226 Gastric cancer
    101341078
   05214 Glioma
    101341078
   05216 Thyroid cancer
    101341078
   05221 Acute myeloid leukemia
    101341078
   05220 Chronic myeloid leukemia
    101341078
   05218 Melanoma
    101341078
   05211 Renal cell carcinoma
    101341078
   05219 Bladder cancer
    101341078
   05215 Prostate cancer
    101341078
   05213 Endometrial cancer
    101341078
   05224 Breast cancer
    101341078
   05223 Non-small cell lung cancer
    101341078
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101341078
   05022 Pathways of neurodegeneration - multiple diseases
    101341078
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101341078
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101341078
   05135 Yersinia infection
    101341078
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101341078
   05170 Human immunodeficiency virus 1 infection
    101341078
   05161 Hepatitis B
    101341078
   05160 Hepatitis C
    101341078
   05164 Influenza A
    101341078
   05163 Human cytomegalovirus infection
    101341078
   05167 Kaposi sarcoma-associated herpesvirus infection
    101341078
   05165 Human papillomavirus infection
    101341078
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101341078
   01522 Endocrine resistance
    101341078
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101341078
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101341078
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: STE group
  STE7 family
   101341078
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo CAMSAP_CC1
Other DBs
NCBI-GeneID: 101341078
NCBI-ProteinID: XP_004378519
UniProt: A0A2Y9DQ05
LinkDB
Position
Unknown
AA seq 400 aa
MLARRKPVLPALTINTAIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEARRIPEEILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELSIGRYPIPPPDAKELEAIFGRPVVDGAEGEPHSISPRPRP
PGRPISGHGVDNRPAMAIFELLDYIVNEPPPKLPSGVFTQDFQEFVNKCLIKNPAERADL
KMLMNHTFIKRSEVEEVDFAGWLCKTLRLNQPGTPTRTAV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgctgccggcgctcaccatcaacaccgccatcgccgag
ggcccgtcccccaccagcgagggcgcctccgaagcaaacttggtagacctccagaagaag
ctagaggagctagagctagacgagcagcagaagaagcgtctggaggccttcctcacccag
aaggccaaggtcggtgaactcaaggatgatgacttcgagaggatctctgagctgggagcc
gggaacggcggggtggtcaccaaagtgcagcacagaccctcgggcctcatcatggcaagg
aagttgattcacctggagatcaagccagccatccggaaccagatcatccgggagctgcag
gtcctgcacgagtgcaactctccgtacatcgtgggcttctacggggccttctacagcgac
ggggagatcagcatctgcatggaacacatggacggaggctccctggaccaggtgctgaaa
gaagccaggaggattccggaagagatcctggggaaggtcagcattgcggttctccggggc
ttggcatacctccgagagaagcaccagatcatgcaccgagatgtgaagccttccaacatc
ctggtcaactccagaggggagatcaagctctgtgactttggggtgagcgggcagctcatt
gactccatggccaactcctttgtgggaacgcgctcctacatgtcgccggagcgcttgcaa
ggcacccactactctgtgcagtcggacatctggagcatgggcttgtcactggtggagctg
tccatcggaaggtaccccatccccccgccggatgccaaggagctggaggccatcttcggc
cggcccgtggtcgatggggccgagggagagccccacagcatctcgccgcggccacggccc
cctggacgccccatcagtggtcacggggtggacaaccggcccgccatggccatcttcgag
ctgctggactacattgtgaatgagcctccccccaagctacccagcggcgtcttcacccag
gacttccaggagtttgtaaataaatgcctgatcaagaacccggcagagcgcgccgacctg
aagatgctgatgaaccacaccttcatcaaacggtccgaggtggaagaagtggattttgca
ggctggctgtgtaaaaccctgaggttgaaccagcccggcacgcccacgcgcaccgccgtg
tga

KEGG   Trichechus manatus latirostris (Florida manatee): 101343332
Entry
101343332         CDS       T05135                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu01522  Endocrine resistance
tmu04010  MAPK signaling pathway
tmu04012  ErbB signaling pathway
tmu04014  Ras signaling pathway
tmu04015  Rap1 signaling pathway
tmu04022  cGMP-PKG signaling pathway
tmu04024  cAMP signaling pathway
tmu04062  Chemokine signaling pathway
tmu04066  HIF-1 signaling pathway
tmu04068  FoxO signaling pathway
tmu04071  Sphingolipid signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04114  Oocyte meiosis
tmu04140  Autophagy - animal
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04210  Apoptosis
tmu04218  Cellular senescence
tmu04270  Vascular smooth muscle contraction
tmu04370  VEGF signaling pathway
tmu04371  Apelin signaling pathway
tmu04380  Osteoclast differentiation
tmu04510  Focal adhesion
tmu04540  Gap junction
tmu04550  Signaling pathways regulating pluripotency of stem cells
tmu04613  Neutrophil extracellular trap formation
tmu04620  Toll-like receptor signaling pathway
tmu04650  Natural killer cell mediated cytotoxicity
tmu04660  T cell receptor signaling pathway
tmu04662  B cell receptor signaling pathway
tmu04664  Fc epsilon RI signaling pathway
tmu04666  Fc gamma R-mediated phagocytosis
tmu04668  TNF signaling pathway
tmu04720  Long-term potentiation
tmu04722  Neurotrophin signaling pathway
tmu04725  Cholinergic synapse
tmu04726  Serotonergic synapse
tmu04730  Long-term depression
tmu04810  Regulation of actin cytoskeleton
tmu04910  Insulin signaling pathway
tmu04912  GnRH signaling pathway
tmu04914  Progesterone-mediated oocyte maturation
tmu04915  Estrogen signaling pathway
tmu04916  Melanogenesis
tmu04917  Prolactin signaling pathway
tmu04919  Thyroid hormone signaling pathway
tmu04921  Oxytocin signaling pathway
tmu04926  Relaxin signaling pathway
tmu04928  Parathyroid hormone synthesis, secretion and action
tmu04929  GnRH secretion
tmu04934  Cushing syndrome
tmu04935  Growth hormone synthesis, secretion and action
tmu05010  Alzheimer disease
tmu05022  Pathways of neurodegeneration - multiple diseases
tmu05034  Alcoholism
tmu05132  Salmonella infection
tmu05135  Yersinia infection
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05163  Human cytomegalovirus infection
tmu05164  Influenza A
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05200  Pathways in cancer
tmu05205  Proteoglycans in cancer
tmu05206  MicroRNAs in cancer
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05212  Pancreatic cancer
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05216  Thyroid cancer
tmu05218  Melanoma
tmu05219  Bladder cancer
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05230  Central carbon metabolism in cancer
tmu05231  Choline metabolism in cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101343332
   04012 ErbB signaling pathway
    101343332
   04014 Ras signaling pathway
    101343332
   04015 Rap1 signaling pathway
    101343332
   04370 VEGF signaling pathway
    101343332
   04371 Apelin signaling pathway
    101343332
   04668 TNF signaling pathway
    101343332
   04066 HIF-1 signaling pathway
    101343332
   04068 FoxO signaling pathway
    101343332
   04072 Phospholipase D signaling pathway
    101343332
   04071 Sphingolipid signaling pathway
    101343332
   04024 cAMP signaling pathway
    101343332
   04022 cGMP-PKG signaling pathway
    101343332
   04151 PI3K-Akt signaling pathway
    101343332
   04150 mTOR signaling pathway
    101343332
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101343332
  09143 Cell growth and death
   04114 Oocyte meiosis
    101343332
   04210 Apoptosis
    101343332
   04218 Cellular senescence
    101343332
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101343332
   04540 Gap junction
    101343332
   04550 Signaling pathways regulating pluripotency of stem cells
    101343332
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101343332
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101343332
   04620 Toll-like receptor signaling pathway
    101343332
   04650 Natural killer cell mediated cytotoxicity
    101343332
   04660 T cell receptor signaling pathway
    101343332
   04662 B cell receptor signaling pathway
    101343332
   04664 Fc epsilon RI signaling pathway
    101343332
   04666 Fc gamma R-mediated phagocytosis
    101343332
   04062 Chemokine signaling pathway
    101343332
  09152 Endocrine system
   04910 Insulin signaling pathway
    101343332
   04929 GnRH secretion
    101343332
   04912 GnRH signaling pathway
    101343332
   04915 Estrogen signaling pathway
    101343332
   04914 Progesterone-mediated oocyte maturation
    101343332
   04917 Prolactin signaling pathway
    101343332
   04921 Oxytocin signaling pathway
    101343332
   04926 Relaxin signaling pathway
    101343332
   04935 Growth hormone synthesis, secretion and action
    101343332
   04919 Thyroid hormone signaling pathway
    101343332
   04928 Parathyroid hormone synthesis, secretion and action
    101343332
   04916 Melanogenesis
    101343332
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101343332
  09156 Nervous system
   04725 Cholinergic synapse
    101343332
   04726 Serotonergic synapse
    101343332
   04720 Long-term potentiation
    101343332
   04730 Long-term depression
    101343332
   04722 Neurotrophin signaling pathway
    101343332
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101343332
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101343332
   05206 MicroRNAs in cancer
    101343332
   05205 Proteoglycans in cancer
    101343332
   05230 Central carbon metabolism in cancer
    101343332
   05231 Choline metabolism in cancer
    101343332
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101343332
  09162 Cancer: specific types
   05210 Colorectal cancer
    101343332
   05212 Pancreatic cancer
    101343332
   05225 Hepatocellular carcinoma
    101343332
   05226 Gastric cancer
    101343332
   05214 Glioma
    101343332
   05216 Thyroid cancer
    101343332
   05221 Acute myeloid leukemia
    101343332
   05220 Chronic myeloid leukemia
    101343332
   05218 Melanoma
    101343332
   05211 Renal cell carcinoma
    101343332
   05219 Bladder cancer
    101343332
   05215 Prostate cancer
    101343332
   05213 Endometrial cancer
    101343332
   05224 Breast cancer
    101343332
   05223 Non-small cell lung cancer
    101343332
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101343332
   05022 Pathways of neurodegeneration - multiple diseases
    101343332
  09165 Substance dependence
   05034 Alcoholism
    101343332
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101343332
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101343332
   05135 Yersinia infection
    101343332
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101343332
   05170 Human immunodeficiency virus 1 infection
    101343332
   05161 Hepatitis B
    101343332
   05160 Hepatitis C
    101343332
   05164 Influenza A
    101343332
   05163 Human cytomegalovirus infection
    101343332
   05167 Kaposi sarcoma-associated herpesvirus infection
    101343332
   05165 Human papillomavirus infection
    101343332
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101343332
   01522 Endocrine resistance
    101343332
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101343332
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101343332
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: STE group
  STE7 family
   101343332
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7
Other DBs
NCBI-GeneID: 101343332
NCBI-ProteinID: XP_004374737
UniProt: A0A2Y9DHL4
LinkDB
Position
Unknown
AA seq 393 aa
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCHVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHGF
IKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaagaaaaagccgacgcccatccagctgaacccggcccccgacggctcggcggtg
aacgggaccagctcggcggagaccaacctggaggccttgcagaagaagctggaggagctg
gaacttgatgaacagcagcggaagcgcctcgaggcctttcttacccagaaacagaaggtg
ggggagctgaaagatgacgactttgagaagatcagtgagctgggtgctggcaatggcggt
gtggttttcaaggtctctcacaagccgtcaggcctggtcatggccagaaagctaattcac
ctggagatcaaacccgcaatccggaaccagatcataagggagctgcaggttctgcacgag
tgcaactccccgtacattgtgggcttctacggtgcgttctacagcgatggcgagatcagc
atctgcatggagcacatggatgggggttccttggatcaagtgctgaagaaagccggaaga
attcctgaacaaattttaggaaaagttagcattgctgtaataaagggactgacttacctg
agggagaagcataagattatgcacagagatgtcaagccctccaacatcctggtgaactcc
cgcggggagatcaagctgtgtgactttggggtcagtgggcagctcatcgattccatggcc
aactcctttgtgggcacgaggtcctacatgtcgccagaaagactccaggggacccactac
tctgtgcagtcagacatctggagcatggggctctctctggtggagatggcggttggaagg
taccccatccctcctccagatgccaaggagctggagctgatgtttgggtgccatgtggag
ggagatgcagctgagacaccgcccaggccgaggacccctgggaggcccctcagctcttat
ggaatggacagcagacctcccatggcgatttttgagctgttggattacatagtcaacgag
cctcctccaaaacttcccagtggagtattcagtctggaatttcaagattttgtgaataaa
tgcctaatcaaaaaccctgcagagagagcagatttgaagcaactcatggttcatgggttt
atcaagagatctgatgctgaagaagtggattttgcaggttggctctgctccacaattggc
cttaaccagcccagcacaccaacccacgcagctggtgtctaa

DBGET integrated database retrieval system