KEGG   Trichechus manatus latirostris (Florida manatee): 101341290
Entry
101341290         CDS       T05135                                 

Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha isoform X1
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01523  Antifolate resistance
tmu04010  MAPK signaling pathway
tmu04014  Ras signaling pathway
tmu04062  Chemokine signaling pathway
tmu04064  NF-kappa B signaling pathway
tmu04068  FoxO signaling pathway
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04210  Apoptosis
tmu04380  Osteoclast differentiation
tmu04620  Toll-like receptor signaling pathway
tmu04621  NOD-like receptor signaling pathway
tmu04622  RIG-I-like receptor signaling pathway
tmu04623  Cytosolic DNA-sensing pathway
tmu04625  C-type lectin receptor signaling pathway
tmu04657  IL-17 signaling pathway
tmu04658  Th1 and Th2 cell differentiation
tmu04659  Th17 cell differentiation
tmu04660  T cell receptor signaling pathway
tmu04662  B cell receptor signaling pathway
tmu04668  TNF signaling pathway
tmu04920  Adipocytokine signaling pathway
tmu05010  Alzheimer disease
tmu05132  Salmonella infection
tmu05135  Yersinia infection
tmu05142  Chagas disease
tmu05145  Toxoplasmosis
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05162  Measles
tmu05163  Human cytomegalovirus infection
tmu05164  Influenza A
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05168  Herpes simplex virus 1 infection
tmu05169  Epstein-Barr virus infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05171  Coronavirus disease - COVID-19
tmu05200  Pathways in cancer
tmu05212  Pancreatic cancer
tmu05215  Prostate cancer
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05222  Small cell lung cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101341290
   04014 Ras signaling pathway
    101341290
   04064 NF-kappa B signaling pathway
    101341290
   04668 TNF signaling pathway
    101341290
   04068 FoxO signaling pathway
    101341290
   04151 PI3K-Akt signaling pathway
    101341290
   04150 mTOR signaling pathway
    101341290
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101341290
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101341290
   04621 NOD-like receptor signaling pathway
    101341290
   04622 RIG-I-like receptor signaling pathway
    101341290
   04623 Cytosolic DNA-sensing pathway
    101341290
   04625 C-type lectin receptor signaling pathway
    101341290
   04660 T cell receptor signaling pathway
    101341290
   04658 Th1 and Th2 cell differentiation
    101341290
   04659 Th17 cell differentiation
    101341290
   04657 IL-17 signaling pathway
    101341290
   04662 B cell receptor signaling pathway
    101341290
   04062 Chemokine signaling pathway
    101341290
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101341290
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101341290
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101341290
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101341290
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101341290
   05221 Acute myeloid leukemia
    101341290
   05220 Chronic myeloid leukemia
    101341290
   05215 Prostate cancer
    101341290
   05222 Small cell lung cancer
    101341290
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101341290
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101341290
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101341290
   05135 Yersinia infection
    101341290
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101341290
   05170 Human immunodeficiency virus 1 infection
    101341290
   05161 Hepatitis B
    101341290
   05160 Hepatitis C
    101341290
   05171 Coronavirus disease - COVID-19
    101341290
   05164 Influenza A
    101341290
   05162 Measles
    101341290
   05168 Herpes simplex virus 1 infection
    101341290
   05163 Human cytomegalovirus infection
    101341290
   05167 Kaposi sarcoma-associated herpesvirus infection
    101341290
   05169 Epstein-Barr virus infection
    101341290
   05165 Human papillomavirus infection
    101341290
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101341290
   05142 Chagas disease
    101341290
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101341290
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101341290
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     101341290
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   101341290
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD
Other DBs
NCBI-GeneID: 101341290
NCBI-ProteinID: XP_004370086
UniProt: A0A2Y9D9M8
LinkDB
Position
Unknown
AA seq 745 aa
MEGPPGLRSGAGGPWVMQERLGTGGFGNVCLYQHRELHHKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHTNVVKACDVPEELNVLINDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKILHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMTGEVRFSSHLPQPNSLCSLIVESMENWLQLMLNWDPQQRGGPVDLVSKQPRC
FILMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHTE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGAVTPQASAWLPPTSAEREHPLSCVVTPQDGETLAQMIEENLNCLGHL
STIIREANEERGGSMMSLDWSWLAE
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggaggggcccccgggcctgcggtccggcgcgggcgggccctgggtgatgcaggagcgg
ctgggcaccggcggcttcgggaacgtctgcctgtaccagcatcgggagcttcatcataag
atagcaattaagtcttgtcgcctagagctaagtaccaaaaacagagaacggtggtgccat
gaaatccagatcatgaagaagttgaaccataccaatgttgtaaaggcctgtgatgttcct
gaggaactcaatgttttgattaatgatgtgcctcttctagcaatggaatactgttctgga
ggagatcttcggaagctactcaacaaaccagaaaattgctgtggacttaaagaaagccag
atactgtctttacttagtgatatagggtctgggattcgatatttgcatgaaaacaaaatt
atacatcgtgacctaaaacctgaaaacatagttcttcaggatgttggtgggaagatattg
cataaaataattgatttgggatatgccaaagacgttgatcaaggaagtttgtgtacatct
tttgtgggaacactgcagtatctggccccagagctttttgagaataagccttacacagcc
actgttgattattggagctttgggaccatggtgtttgaatgtattgctggatataggcct
tttttgcatcatctgcagccatttacctggcatgagaagattaagaagaaggatccaaag
tgtatatttgcgtgtgaagagatgactggagaagttcggttcagtagccatttacctcag
ccaaatagcctttgtagtttaatagtagaatccatggagaattggctgcagttgatgctg
aattgggatcctcagcagagagggggacctgttgatcttgtttcaaagcagccaagatgt
ttcatattaatggatcacattctgaatttgaagatagtacacatcctaaatatgacttct
gcaaagataatttcttttttgttgccacctgatgaaagtcttcattcactacagtctcgt
attgagcgtgaaactgggataaatactggttctcaagagcttctttcagagacgggaatt
tctctggaccctcggaaaccagcctctcaatgtgttctagatggagttagaggctgtgat
agctatatggtttatttgtttgataaaagtaagactgtatatgaaggtccatttgcttcc
agaagtttatctgactgtgtaaattatattgtacaggacagcaaaatacagttaccaatt
atacaactgcggaaagtatgggctgaagcagtgcattatgtatctgggctaaaagaagac
tacagcagactctttcagggacaaagagcagcaatgttaagtcttcttagatataatgct
aacttgacaaaaatgaagaacactttgatctcagcatctcagcaactgaaagctaaattg
gagttttttcacaaaagtattcagctggacttggagagatacagtgagcagatgacatat
gggatatcctcagaaaaaatgttaaaagcatggaaagaaatggaagaaaaggccatccac
tatgctgaggttggtgtcattggatacctggaggatcagatcatgtccctgcacactgaa
atcatggagctacagaagagcccctatggaagacgccagggagacttgatggaatctctg
gagcagcgtgccatcgatctatataagcagttaaagcatagaccttcagatcactcctac
agcgacagcacggagatggtgaagatcattgtgcacactgtgcagagtcaggaccgtgtt
ctcaaggagctgtttggtcatctgagcaagttattaggctgtaagcagaagattatcgat
ctactccccaaggtggaagtggccctcagtaacatcaaagaagccgacaatacggtcatg
tttatgcagggaaagaggcagaaagaaatatggcatctccttaaaattgcctgtacacag
agttctgcccggtctcttgtaggatccagtctagaaggtgcagtaaccccgcaggcatca
gcatggctgcccccaacttcagcagaacgtgaacatcctctgtcatgcgtggtaactcct
caagatggggagactttagcacaaatgatagaagaaaatttgaattgtcttggccattta
agcactattattcgtgaagcaaatgaggaacggggcggtagtatgatgagtcttgactgg
agttggttagcagaatga

KEGG   Trichechus manatus latirostris (Florida manatee): 101347574
Entry
101347574         CDS       T05135                                 

Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01523  Antifolate resistance
tmu04010  MAPK signaling pathway
tmu04014  Ras signaling pathway
tmu04062  Chemokine signaling pathway
tmu04064  NF-kappa B signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04210  Apoptosis
tmu04380  Osteoclast differentiation
tmu04620  Toll-like receptor signaling pathway
tmu04621  NOD-like receptor signaling pathway
tmu04622  RIG-I-like receptor signaling pathway
tmu04623  Cytosolic DNA-sensing pathway
tmu04625  C-type lectin receptor signaling pathway
tmu04657  IL-17 signaling pathway
tmu04658  Th1 and Th2 cell differentiation
tmu04659  Th17 cell differentiation
tmu04660  T cell receptor signaling pathway
tmu04662  B cell receptor signaling pathway
tmu04668  TNF signaling pathway
tmu04920  Adipocytokine signaling pathway
tmu05132  Salmonella infection
tmu05135  Yersinia infection
tmu05142  Chagas disease
tmu05145  Toxoplasmosis
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05162  Measles
tmu05163  Human cytomegalovirus infection
tmu05164  Influenza A
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05168  Herpes simplex virus 1 infection
tmu05169  Epstein-Barr virus infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05171  Coronavirus disease - COVID-19
tmu05200  Pathways in cancer
tmu05203  Viral carcinogenesis
tmu05212  Pancreatic cancer
tmu05215  Prostate cancer
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05222  Small cell lung cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tmu05340  Primary immunodeficiency
tmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101347574
   04014 Ras signaling pathway
    101347574
   04064 NF-kappa B signaling pathway
    101347574
   04668 TNF signaling pathway
    101347574
   04151 PI3K-Akt signaling pathway
    101347574
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101347574
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101347574
   04621 NOD-like receptor signaling pathway
    101347574
   04622 RIG-I-like receptor signaling pathway
    101347574
   04623 Cytosolic DNA-sensing pathway
    101347574
   04625 C-type lectin receptor signaling pathway
    101347574
   04660 T cell receptor signaling pathway
    101347574
   04658 Th1 and Th2 cell differentiation
    101347574
   04659 Th17 cell differentiation
    101347574
   04657 IL-17 signaling pathway
    101347574
   04662 B cell receptor signaling pathway
    101347574
   04062 Chemokine signaling pathway
    101347574
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101347574
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101347574
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101347574
   05203 Viral carcinogenesis
    101347574
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101347574
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101347574
   05221 Acute myeloid leukemia
    101347574
   05220 Chronic myeloid leukemia
    101347574
   05215 Prostate cancer
    101347574
   05222 Small cell lung cancer
    101347574
  09163 Immune disease
   05340 Primary immunodeficiency
    101347574
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101347574
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101347574
   05135 Yersinia infection
    101347574
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101347574
   05170 Human immunodeficiency virus 1 infection
    101347574
   05161 Hepatitis B
    101347574
   05160 Hepatitis C
    101347574
   05171 Coronavirus disease - COVID-19
    101347574
   05164 Influenza A
    101347574
   05162 Measles
    101347574
   05168 Herpes simplex virus 1 infection
    101347574
   05163 Human cytomegalovirus infection
    101347574
   05167 Kaposi sarcoma-associated herpesvirus infection
    101347574
   05169 Epstein-Barr virus infection
    101347574
   05165 Human papillomavirus infection
    101347574
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101347574
   05142 Chagas disease
    101347574
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101347574
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101347574
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   101347574
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 LLC1
Other DBs
NCBI-GeneID: 101347574
NCBI-ProteinID: XP_004390656
UniProt: A0A2Y9EB34
LinkDB
Position
Unknown
AA seq 421 aa
MSRHLRKNPLCEMVQPSGGPVGDQDMLAEESSLGKPAMLHLPSEQGASEPLQRCLEENQE
LRDAIRQSNQMLRERCEELVHFQVSQREEKEFLMQKFQKARKLVEKLSLEKLELKRQREQ
ALQEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAANKDRQALEGRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQSQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQD
YDNHIKSSMASSERNRGIQLEDLKQQLQQAEEALVAKQELIDKLKEEAEQHKTVMETVPV
LRAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKISSQESARALIEDMRK
RHVEGSQPPLPPAPAHHSFHLALLSQRRSPPEEPPDFCCPKCQYQAPDIDTLQIHVMECI
E
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgagcaggcatctccggaagaatccgctttgtgagatggtgcagcccagtggtggtcca
gtgggggaccaggacatgctggctgaagagtcttctctggggaagccagccatgcttcac
ctgccttcagagcagggtgcttccgagcccctccagcgctgtctggaggagaatcaggag
ctccgagatgccatccggcagagcaaccagatgctccgggagcgctgtgaggagctggtg
catttccaggtcagccagagagaggagaaggagttcctcatgcagaagttccagaaggcc
cggaagctggtagagaaactgagcctggagaagcttgagctgaagaggcagagggagcag
gccctgcaggaggtggagcacctgaagagatgccagcagcagatggctgaggacaaggcc
tcggtgaaagcccaggtgacgtccctgctgggggagctccaggagagccagagccgctta
gaggctgccaacaaggaccggcaggctttggaaggcagggcccgggcggccagcgagcag
gcccggcagctggagagcgagcgggaagcgctgcagcagcagcacagtgtgcaggtggac
cagctgcgcatgcagagccagagcgtggaggccgcgctgcgcatggagcgccaggccgcc
tccgaggagaagcggaagctggcccagttacaagtggcttatcaccagctcttccaagac
tatgacaatcacatcaagagcagcatggccagcagtgagcgaaaccgaggcatccagctg
gaagatctgaagcagcagctgcagcaggccgaggaggccctggtggccaagcaggagctg
atcgacaagctgaaggaggaggcggagcagcacaagacagtgatggagaccgtcccggtg
cttagggcccaggcggatatctataaagcggactttcaggctgagaggcaggcccgggag
aagctggccgagaagaaggagctgctgcaggagcagctggagcagctgcagagggagtac
agcaagctgaagatcagctcacaggagtcagccagggctctgattgaggatatgcggaag
cggcacgtcgagggctcccagccgcctttgccccctgccccagctcatcactcctttcac
ctggccctgctcagccagaggaggagcccccccgaagagccacctgatttctgttgtccc
aagtgccagtaccaggctccggatatcgataccctgcagatacacgtcatggagtgcatc
gagtag

KEGG   Trichechus manatus latirostris (Florida manatee): 101351256
Entry
101351256         CDS       T05135                                 

Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit beta isoform X1
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01523  Antifolate resistance
tmu04010  MAPK signaling pathway
tmu04014  Ras signaling pathway
tmu04062  Chemokine signaling pathway
tmu04064  NF-kappa B signaling pathway
tmu04068  FoxO signaling pathway
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04210  Apoptosis
tmu04380  Osteoclast differentiation
tmu04620  Toll-like receptor signaling pathway
tmu04621  NOD-like receptor signaling pathway
tmu04622  RIG-I-like receptor signaling pathway
tmu04623  Cytosolic DNA-sensing pathway
tmu04625  C-type lectin receptor signaling pathway
tmu04657  IL-17 signaling pathway
tmu04658  Th1 and Th2 cell differentiation
tmu04659  Th17 cell differentiation
tmu04660  T cell receptor signaling pathway
tmu04662  B cell receptor signaling pathway
tmu04668  TNF signaling pathway
tmu04722  Neurotrophin signaling pathway
tmu04910  Insulin signaling pathway
tmu04920  Adipocytokine signaling pathway
tmu04930  Type II diabetes mellitus
tmu04931  Insulin resistance
tmu04932  Non-alcoholic fatty liver disease
tmu05010  Alzheimer disease
tmu05132  Salmonella infection
tmu05135  Yersinia infection
tmu05142  Chagas disease
tmu05145  Toxoplasmosis
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05162  Measles
tmu05163  Human cytomegalovirus infection
tmu05164  Influenza A
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05168  Herpes simplex virus 1 infection
tmu05169  Epstein-Barr virus infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05171  Coronavirus disease - COVID-19
tmu05200  Pathways in cancer
tmu05206  MicroRNAs in cancer
tmu05212  Pancreatic cancer
tmu05215  Prostate cancer
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05222  Small cell lung cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101351256
   04014 Ras signaling pathway
    101351256
   04064 NF-kappa B signaling pathway
    101351256
   04668 TNF signaling pathway
    101351256
   04068 FoxO signaling pathway
    101351256
   04151 PI3K-Akt signaling pathway
    101351256
   04150 mTOR signaling pathway
    101351256
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101351256
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101351256
   04621 NOD-like receptor signaling pathway
    101351256
   04622 RIG-I-like receptor signaling pathway
    101351256
   04623 Cytosolic DNA-sensing pathway
    101351256
   04625 C-type lectin receptor signaling pathway
    101351256
   04660 T cell receptor signaling pathway
    101351256
   04658 Th1 and Th2 cell differentiation
    101351256
   04659 Th17 cell differentiation
    101351256
   04657 IL-17 signaling pathway
    101351256
   04662 B cell receptor signaling pathway
    101351256
   04062 Chemokine signaling pathway
    101351256
  09152 Endocrine system
   04910 Insulin signaling pathway
    101351256
   04920 Adipocytokine signaling pathway
    101351256
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101351256
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101351256
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101351256
   05206 MicroRNAs in cancer
    101351256
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101351256
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101351256
   05221 Acute myeloid leukemia
    101351256
   05220 Chronic myeloid leukemia
    101351256
   05215 Prostate cancer
    101351256
   05222 Small cell lung cancer
    101351256
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101351256
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101351256
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101351256
   04932 Non-alcoholic fatty liver disease
    101351256
   04931 Insulin resistance
    101351256
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101351256
   05135 Yersinia infection
    101351256
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101351256
   05170 Human immunodeficiency virus 1 infection
    101351256
   05161 Hepatitis B
    101351256
   05160 Hepatitis C
    101351256
   05171 Coronavirus disease - COVID-19
    101351256
   05164 Influenza A
    101351256
   05162 Measles
    101351256
   05168 Herpes simplex virus 1 infection
    101351256
   05163 Human cytomegalovirus infection
    101351256
   05167 Kaposi sarcoma-associated herpesvirus infection
    101351256
   05169 Epstein-Barr virus infection
    101351256
   05165 Human papillomavirus infection
    101351256
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101351256
   05142 Chagas disease
    101351256
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101351256
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101351256
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     101351256
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   101351256
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo ubiquitin APH YrbL-PhoP_reg Med20 Glyco_hydro_65m
Other DBs
NCBI-GeneID: 101351256
NCBI-ProteinID: XP_004382140
UniProt: A0A2Y9RFY1
LinkDB
Position
Unknown
AA seq 756 aa
MSWSPSLPTQTCGVWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLNHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
MDIVVSEDLSGAVKFSSSLPYPNNLNSVLAQRLEKWLQLMLMWHPRQRGTDPVYGPNGCF
KALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLA
LIPDKPATQCVSDGKLNEGRTLDMDLVFLFDNSKVTYEMKISPRPQPESVSCILQEPKKN
LSFFHLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSVQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKHLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTDGDSQEMVRLLLQAIQG
FEKKVRVIYSQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNASRLSHPGQLMTQPATAPDGLAESAKKSEELVAEAHTLCTRLE
NAMQDTMKTQDQSFMTLDWSWLQAEEEEQNSLEQAS
NT seq 2271 nt   +upstreamnt  +downstreamnt
atgagctggtcaccttccctgccaacccagacatgtggggtctgggaaatgaaggaacga
cttgggacagggggatttggaaacgtcatccggtggcacaatcaggaaacaggtgagcag
attgctatcaagcagtgccgacaggagctcagtccccggaaccgagagcgatggtgcctg
gaaatccagatcatgagaaggctgaaccaccccaacgtggtggctgcccgggatgtccct
gaggggatgcagaacttggcccccaatgacttgcccctcctggccatggagtactgtcaa
ggaggagatctccggaagtacctgaaccagtttgagaactgctgtggtctgcgggaagga
gccatcctcaccttgctcagtgacattgcctctgcgcttagataccttcatgaaaacagg
atcatccatcgggatctaaagccagaaaacatcgtcctgcagcaaggagagcagaggtta
atacacaaaattattgacctaggatatgccaaggagctggatcagggcagcctttgtact
tcctttgtggggaccctgcaatacctggccccggagctgctggagcagcagaagtacacg
gtgacggtggactactggagcttcggcaccctggcttttgagtgcatcacgggcttccgg
cctttcctccccaactggcagcctgtgcagtggcattccaaagtccggcagaagagtgag
atggacatcgttgtcagtgaagacttgagcggagcagtgaagttttcaagctcgttaccc
taccccaataatctcaacagtgtactggcacagcgcctggagaagtggctgcagctgatg
ttaatgtggcacccccggcagaggggcacagatccagtgtacgggcccaatggctgtttc
aaggccctggacgacatcttaaacttgaagctggttcatatcttgaacatggtcacaggc
accattcacacctacccagtgacagaggacgagagtctgcagagcttaaaggccagaatc
cagcaagacacgggaatcccagaggaggaccaggagctgctgcaagaagcgggtctggca
ttgatccccgacaagcctgccacgcagtgtgtttcagatggcaagctaaatgagggccgc
acattggacatggatctcgtttttctctttgacaacagtaaagtcacctatgagatgaag
atttcccctcggcctcaacctgaaagtgtcagctgtatccttcaagagcccaagaagaat
ctctctttcttccacctgaggaaggtgtggggacaggtctggcacagtatccagaccctg
aaggaagattgtaaccggctgcagcagggacagcgagctgccatgatgaatctcctccgg
aataacagctgtctgtccaagatgaagaattccatggcttccatgtctcagcagctcaag
gccaagttggatttctttaaaaccagcgtccagattgacctggagaagtatagtgagcaa
actgagtttggaatcacttcagataaattgctgctggcttggagggaaatggaacaggca
gtggagctctgcgggcgggaaaatgaagtgaaacatctggtggaacggatgatggcactg
cagacagacatcgtggacttacagaggagcccaatgggtcggaagcaggggggaacactg
gatgacctagaagagcaagccagggagctttacaggagactaagggagaaaccaagagac
cagcgaactgatggtgacagtcaggagatggtacggctgctgctccaggcaatccaaggc
tttgagaagaaagtgcgagtgatttatagtcagctcagtaaaactgtagtttgcaagcag
aaggctctggaattgttgcccaaggtggaagaggtggtcagtttaatgaatgaggatgag
aagactgtggttcggcttcaggagaagcgacagaaggagctctggaatctcctgaagatc
gcttgtagcaaggtacgtggtcctgtcagtggaagcccagatagcatgaatgcctctcgt
cttagtcaccctggtcagctgatgactcagcctgccactgcccccgacggcttagctgag
tcagccaagaaaagtgaagaactggtggctgaagcacatactctctgcacccggctagaa
aatgcaatgcaagacaccatgaaaacgcaggaccagagttttatgactctggactggagc
tggttacaagcagaagaagaagagcagaatagcctggagcaggcctcgtga

DBGET integrated database retrieval system