KEGG   Trichechus manatus latirostris (Florida manatee): 101341432
Entry
101341432         CDS       T05135                                 

Definition
(RefSeq) cyclin-A2
  KO
K06627  cyclin-A
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04110  Cell cycle
tmu04152  AMPK signaling pathway
tmu04218  Cellular senescence
tmu04914  Progesterone-mediated oocyte maturation
tmu05161  Hepatitis B
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05169  Epstein-Barr virus infection
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05203  Viral carcinogenesis
tmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    101341432
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101341432
   04218 Cellular senescence
    101341432
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101341432
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101341432
   05202 Transcriptional misregulation in cancer
    101341432
   05203 Viral carcinogenesis
    101341432
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101341432
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101341432
   05161 Hepatitis B
    101341432
   05169 Epstein-Barr virus infection
    101341432
   05165 Human papillomavirus infection
    101341432
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tmu03032]
    101341432
   03036 Chromosome and associated proteins [BR:tmu03036]
    101341432
DNA replication proteins [BR:tmu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    101341432
Chromosome and associated proteins [BR:tmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    101341432
SSDB
Motif
Pfam: Cyclin_N Cyclin_N2 Cyclin_C
Other DBs
NCBI-GeneID: 101341432
NCBI-ProteinID: XP_023596893
UniProt: A0A2Y9RYV8
LinkDB
Position
Unknown
AA seq 328 aa
MTKIVMTRRVAPLKDIPVNDERVTVPPWKGNSKQPAFTIHVDEEEEKTEKRPAESKKTEC
EDALAFNSAVTLPGPRKPLGSLDYPMDGSFVLSESPRTMDMSIVSEDEKPVSVNEVPDYH
EDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLYLAVNYI
DRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVL
KVLAFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSIIAGAA
FHIALYTITGQSWVSYLTPTKVMRGEKR
NT seq 987 nt   +upstreamnt  +downstreamnt
atgacgaagattgtaatgacgcgacgggttgcacctcttaaggatattcctgtaaatgat
gagcgtgtcactgttcctccctggaaaggaaacagtaaacagcctgcattcaccattcat
gtggatgaagaagaagaaaagactgaaaagagaccagctgaatctaaaaaaacagagtgt
gaagatgccctggcttttaattcagctgttactttacctggaccaagaaaacccctgggg
tctcttgattatccaatggatggtagttttgttctttcagagtcaccgcgcactatggac
atgtcgattgtatcagaagatgagaaaccagtgagtgtcaatgaagtaccagactaccat
gaagacattcacacgtaccttagggaaatggaggtgaagtgtaagcctaaagtgggttat
atgaagaagcaaccagacatcactaacagtatgagggctatcctcgtggactggttagtt
gaagtaggcgaagaatataaactacagaatgagaccctgtacttggctgtgaactacatt
gataggttcctttcatcaatgtccgtattgagaggaaaacttcagcttgtgggcactgct
gctatgctactagcctcaaagtttgaagaaatatatcctccagaagtagcagaatttgta
tacattacagatgacacctataccaagaaacaagttctgagaatggaacatctagttttg
aaagtccttgcgtttgacttagcagcaccaacagtaaatcagtttcttacccagtacttt
ctgcatcagcagcctgcaaactgcaaagttgaaagtttagcaatgtttttgggagagtta
agtttgatagatgccgacccatacctaaagtatttgccatcaattattgctggagcagcc
tttcatatagcactctacacaatcacaggacaaagctgggtcagttatctaacacctact
aaggttatgagaggagaaaaacgatga

KEGG   Trichechus manatus latirostris (Florida manatee): 101347141
Entry
101347141         CDS       T05135                                 

Definition
(RefSeq) cyclin-A1
  KO
K06627  cyclin-A
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04110  Cell cycle
tmu04152  AMPK signaling pathway
tmu04218  Cellular senescence
tmu04914  Progesterone-mediated oocyte maturation
tmu05161  Hepatitis B
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05169  Epstein-Barr virus infection
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05203  Viral carcinogenesis
tmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    101347141
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101347141
   04218 Cellular senescence
    101347141
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101347141
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101347141
   05202 Transcriptional misregulation in cancer
    101347141
   05203 Viral carcinogenesis
    101347141
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101347141
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101347141
   05161 Hepatitis B
    101347141
   05169 Epstein-Barr virus infection
    101347141
   05165 Human papillomavirus infection
    101347141
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tmu03032]
    101347141
   03036 Chromosome and associated proteins [BR:tmu03036]
    101347141
DNA replication proteins [BR:tmu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    101347141
Chromosome and associated proteins [BR:tmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    101347141
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2
Other DBs
NCBI-GeneID: 101347141
NCBI-ProteinID: XP_004390958
UniProt: A0A2Y9ECQ7
LinkDB
Position
Unknown
AA seq 421 aa
MRRSGPKSGVVLAPVAGVHDACQMISRAQLGQEPPRRTVLGVLTENGQYRRACGQGITAI
GCFSGSENAVPPAGKKAPSDCGVRVPSMQGFDIYMDEPGQGDRESSSGREEMVFEEVYGV
DTSAPKSDLHFLLDFSTASPMLVDSSLHSQSEDVSDFGSDVINVTEYAEEIHQYLREAEV
RHRPKAHYLRKQPDITEGMRAILVDWLVEVGEEYKLHTETLYLAVNFLDRFLSCMSVLRG
KLQLVGTAAILLASKYEEIYPPEVDEFVYITDDTYTKRQLLRMEHLLLKVLDFDLTVPTT
NQFLLQYLRRQGVCIRTENLAKYVAELSLLEADPFLKYLPSLIAAAAYCLANYTINRHFW
PETLAAFTGYSLSEIVPCLSELHRACLNMPRRPQQAIREKYKASKYLHVSLMEPPAVLPL
Q
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgcggcgaagcggacccaagagcggcgttgttctggccccggtggctggggtccatgat
gcctgtcagatgatcagcagagcccagctgggccaggagcccccccggaggaccgtgctg
ggggtgctcaccgagaacgggcagtacaggagggcctgcggccaggggatcacagcaatc
gggtgtttctctggatcggaaaatgccgtccctccagctgggaaaaaggcgccgtctgac
tgcggggtccgtgtgccgtccatgcaaggattcgatatctacatggatgagcctggacag
ggagacagagagagctcttcagggagagaggaaatggtgtttgaggaggtgtacggggta
gacaccagcgctcccaagtcggatctccacttcctgctggatttcagcacagcttcccca
atgctggtcgattcctctctccattctcagtctgaagatgtgtccgattttggttccgac
gtgataaatgtgactgagtatgctgaagaaattcatcaatatctcagagaagctgaagtg
agacacagacccaaagctcactacctgaggaagcagccagacatcacggagggcatgcgt
gccatcctggtggactggctggtggaggtcggggaggagtacaagctccacacggagact
ctgtacctggccgtcaacttcctggacaggttcctgtcgtgcatgtcagttctgaggggg
aagctgcagcttgtggggacggcggctattcttctggcctcgaaatacgaagagatctat
ccccccgaagtggatgagtttgtctatataactgatgatacgtacaccaagcgacaactg
ttaagaatggaacatctgctgctgaaagtcctggactttgacctgactgtaccaaccacc
aaccagttcctccttcagtacttaaggaggcaaggggtgtgcattcggaccgagaacctg
gccaagtacgtagcagaactgagtctactggaagctgatccgttcctaaaatatcttcct
tcactgatagccgcagcagcttattgtctggcaaactataccatcaacaggcacttctgg
ccagaaacccttgctgcctttacaggctactcgctgagtgagattgtgccctgcctgagt
gagctgcacagagcctgccttaacatgccccgtcgacctcagcaagcaatcagggagaag
tacaaggcttcaaagtacctgcacgtgtctctcatggagcctcctgctgtccttcctctg
cagtga

DBGET integrated database retrieval system