KEGG   Trichechus manatus latirostris (Florida manatee): 101341696
Entry
101341696         CDS       T05135                                 

Definition
(RefSeq) transcription factor 7-like 1
  KO
K04490  transcription factor 7-like 1
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04310  Wnt signaling pathway
tmu04390  Hippo signaling pathway
tmu04520  Adherens junction
tmu04916  Melanogenesis
tmu04934  Cushing syndrome
tmu05132  Salmonella infection
tmu05165  Human papillomavirus infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05200  Pathways in cancer
tmu05210  Colorectal cancer
tmu05213  Endometrial cancer
tmu05215  Prostate cancer
tmu05216  Thyroid cancer
tmu05217  Basal cell carcinoma
tmu05221  Acute myeloid leukemia
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101341696
   04390 Hippo signaling pathway
    101341696
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101341696
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101341696
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101341696
  09162 Cancer: specific types
   05210 Colorectal cancer
    101341696
   05225 Hepatocellular carcinoma
    101341696
   05226 Gastric cancer
    101341696
   05216 Thyroid cancer
    101341696
   05221 Acute myeloid leukemia
    101341696
   05217 Basal cell carcinoma
    101341696
   05215 Prostate cancer
    101341696
   05213 Endometrial cancer
    101341696
   05224 Breast cancer
    101341696
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101341696
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101341696
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101341696
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101341696
   05165 Human papillomavirus infection
    101341696
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tmu03000]
    101341696
Transcription factors [BR:tmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    101341696
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2 NINJA_B
Other DBs
NCBI-GeneID: 101341696
NCBI-ProteinID: XP_004388303
UniProt: A0A2Y9E755
LinkDB
Position
Unknown
AA seq 463 aa
MIPDLSSPYLPNGPLSPGGARTYLQMKWPLLDVPSSTTVKDTRSPSPAHLSNKVPVVQHP
HHMHPLTPLITYSNDHFSPGSPPTHLSPEIDPKTGIPRPPHPSELSPYYPLSPGAVGQIP
HPLGWLVPQQGQPMYSLPPGGFRHSYPALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGI
PHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKPLNAFMLYMKEMRAKVV
AECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYGKKKKR
KREKQLSQTQSQQQAQEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPATPSAA
LASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAATSSSQMGSQPPVLSRP
LPLGSMPTALLTSPPSFPATLHAHQALPVLQAQPLSLVTKSAH
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgatcccggacctgagcagcccgtatctccccaacggtcccttgtctcctggaggagcg
cgcacgtacctgcagatgaaatggccccttctcgatgtcccctccagcaccacagtcaag
gacacgaggtccccatccccggcacacctgtctaataaagttcctgtcgtgcagcaccca
catcacatgcatccactgacacccctcatcacctacagcaatgaccacttctctcctggc
tcccctcccacgcacctctccccagagattgatccaaagacaggaatcccccggccccct
cacccatctgagctgtcaccatattacccactatcacccggagctgtcggacaaatcccc
catcccctcggctggctcgtcccacagcaaggacagcccatgtactccctgcctcctggt
ggcttccggcactcttaccctgccctcgctatgaatgcctccatgtccagcctggtttcc
agtcggttctcccctcacatggtggctccggcccatcctggtctgcccacctcagggatc
ccccaccctgccatcgtctcccccatcgtcaagcaggagccagcgccccccagcctgagc
ccagcagtgagtgtgaaatcaccagtgacggtgaaaaaggaggaagaaaagaagcctcat
gtgaagaagcctctgaatgccttcatgttatatatgaaggagatgagggccaaggtggtg
gctgagtgcactctgaaggaaagtgcagccattaaccaaatcctgggaagaaagtggcac
aacctgtctcgagaagaacaggccaagtactatgagctggcccggaaggagcggcagctt
cactcccagctctaccccacctggtcagcccgggacaactatggtaagaaaaagaagaga
aagagagaaaagcagctgtcacagacgcagtcacagcaacaagcccaagaggcagagggt
gctctggcctctaagagcaagaagccatgtgttcagtacctgccccctgagaagccctgt
gacagccctgcctcctcccacggtagcatgctggactcccctgctaccccttccgccgcc
ttggcctcaccagctgcccctgctgcaacccactcggagcaagctcagcccctctccctc
accaccaagccagagacccgagcccagctggctctccactcggctgccttcctgtcagcc
aaggctgcagccacctcctctagccagatgggcagccagcctcccgtgctgtcacggccc
ctccctcttgggtccatgccaacagctctgctgacttctcccccttccttcccagccaca
ctccatgcccaccaggccctcccagtactacaggcccagcctctttccttggtcaccaag
tctgcccactag

KEGG   Trichechus manatus latirostris (Florida manatee): 101345125
Entry
101345125         CDS       T05135                                 

Definition
(RefSeq) lymphoid enhancer-binding factor 1 isoform X2
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04310  Wnt signaling pathway
tmu04390  Hippo signaling pathway
tmu04520  Adherens junction
tmu04916  Melanogenesis
tmu04934  Cushing syndrome
tmu05132  Salmonella infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05200  Pathways in cancer
tmu05210  Colorectal cancer
tmu05213  Endometrial cancer
tmu05215  Prostate cancer
tmu05216  Thyroid cancer
tmu05217  Basal cell carcinoma
tmu05221  Acute myeloid leukemia
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101345125
   04390 Hippo signaling pathway
    101345125
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101345125
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101345125
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101345125
  09162 Cancer: specific types
   05210 Colorectal cancer
    101345125
   05225 Hepatocellular carcinoma
    101345125
   05226 Gastric cancer
    101345125
   05216 Thyroid cancer
    101345125
   05221 Acute myeloid leukemia
    101345125
   05217 Basal cell carcinoma
    101345125
   05215 Prostate cancer
    101345125
   05213 Endometrial cancer
    101345125
   05224 Breast cancer
    101345125
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101345125
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101345125
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101345125
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101345125
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tmu03000]
    101345125
Transcription factors [BR:tmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    101345125
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 101345125
NCBI-ProteinID: XP_004380281
UniProt: A0A2Y9DSJ2
LinkDB
Position
Unknown
AA seq 399 aa
MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQTSQESYHDKAREHPDEGKHPDGGLYNKGPSYSGYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNS
KQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMS
RFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIK
KPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHM
QLYPGWSARDNYGKKKKRKREKLQESTSGTGPRMTAAYI
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgccccagctctccgggggaggcggcggcggcgggggggacccggaactctgcgccacg
gacgagatgatcccgtttaaggacgagggcgacccccagaaggagaagatctttgccgag
atcagtcaccccgaagaggaaggcgacttagccgacatcaagtcttccttggtcaatgaa
tccgaaatcatcccagctagcaacggacacgaggtggccagacaagctcaaacctctcag
gagtcctaccatgacaaggccagagaacaccctgatgaaggaaagcatccagatggaggc
ctctacaacaagggaccctcctactcgggttattccgggtacataatgatgccaaatatg
aataacgacccgtacatgtcaaatggatctctttctccacccatcccaagaacatcaaat
aaagtgcccgtggtgcagccatcccatgcggtccatcctctcacccccctcatcacttac
agtgacgagcacttttctccaggatcacacccgtcacacatcccgtcagatgtcaactcc
aaacaaggcatgtccagacatcctccagctcctgatatccccaccttttatcccctgtct
ccgggtggtgttggacagattaccccacctcttggctggcaaggtcagcctgtatatccc
atcacgggtggattcaggcaaccctacccatcctcactgtctgtggacacttccatgtcc
aggttttcccatcatatgattcctggtcctcctggtccccacacaactggcatccctcat
ccagctattgtaacgcctcaggtcaaacaggaacatccccacactgacagtgacctaatg
cacgtgaagcctcagcatgaacagagaaaggagcaggagccaaaaagacctcacattaag
aaacctctgaatgcttttatgttatacatgaaagaaatgagagcaaatgtcgtagctgag
tgtactctaaaggaaagtgcagctatcaaccagattctaggcagaaggtggcacgccctc
tcccgtgaagagcaggctaagtattatgaattagcgcggaaggaaagacagctacatatg
cagctttatccaggctggtctgcaagagacaattatggtaagaaaaagaagaggaagaga
gagaagctacaggaatctacatcaggtacaggtccaagaatgacagctgcctacatctga

KEGG   Trichechus manatus latirostris (Florida manatee): 101345532
Entry
101345532         CDS       T05135                                 

Definition
(RefSeq) transcription factor 7-like 2 isoform X1
  KO
K04491  transcription factor 7-like 2
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04310  Wnt signaling pathway
tmu04390  Hippo signaling pathway
tmu04520  Adherens junction
tmu04916  Melanogenesis
tmu04934  Cushing syndrome
tmu05132  Salmonella infection
tmu05165  Human papillomavirus infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05200  Pathways in cancer
tmu05210  Colorectal cancer
tmu05213  Endometrial cancer
tmu05215  Prostate cancer
tmu05216  Thyroid cancer
tmu05217  Basal cell carcinoma
tmu05221  Acute myeloid leukemia
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101345532
   04390 Hippo signaling pathway
    101345532
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101345532
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101345532
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101345532
  09162 Cancer: specific types
   05210 Colorectal cancer
    101345532
   05225 Hepatocellular carcinoma
    101345532
   05226 Gastric cancer
    101345532
   05216 Thyroid cancer
    101345532
   05221 Acute myeloid leukemia
    101345532
   05217 Basal cell carcinoma
    101345532
   05215 Prostate cancer
    101345532
   05213 Endometrial cancer
    101345532
   05224 Breast cancer
    101345532
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101345532
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101345532
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101345532
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101345532
   05165 Human papillomavirus infection
    101345532
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tmu03000]
    101345532
Transcription factors [BR:tmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    101345532
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 101345532
NCBI-ProteinID: XP_023585719
UniProt: A0A2Y9R251
LinkDB
Position
Unknown
AA seq 381 aa
MKWPLLDVQAGSLQSRQALKDARSPSPAHIVCPLPCCTQGHDCQHFYPPSDFTVSTQVFR
DMKRNHSLQKVGEPWCMESNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDP
KTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTV
NASMSSFLSSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKK
EEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYE
LARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITGEKKS
AFATYKVKAAASAHPLQMEAY
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgaaatggccactgcttgatgttcaagcaggaagcctccagagtagacaagccctcaag
gacgcccggtctccatccccggcacacatcgtctgtcccctcccttgctgcactcaggga
catgactgtcagcacttctaccccccctcagacttcactgtcagcactcaagtcttcagg
gacatgaaaaggaaccactccttacaaaaggttggggagccctggtgtatggagtcgaac
aaagtgccagttgtgcagcaccctcaccatgtacaccctctcacgcctcttattacgtac
agcaatgaacacttcaccccaggaaacccacctccacacttaccagccgacgtagacccc
aaaacaggaatcccacggcctccgcaccctccagatatatcgccgtattacccactatcg
cctggcaccgtaggacaaatcccccatccgctaggatggttagtaccacagcaaggtcag
cctgtgtatccaatcacgacaggaggattcagacacccctacccaacagctctgaccgtc
aatgcttccatgtccagctttctgtcttctaggttcccaccccatatggtcccaccacat
catactctgcacactaccggcattccccacccggccatagtcacaccaacagtcaaacag
gaatcctcccagagtgacgtcggctcactgcatagctcaaagcatcaggactccaaaaag
gaagaagaaaagaagaagccccacataaagaaacctcttaacgcattcatgttgtatatg
aaggaaatgagagcaaaggtcgtggccgagtgcacgttgaaagaaagtgcagccatcaac
cagatcctgggtcggaggtggcatgcactgtccagagaagagcaagcgaagtactatgag
ctagcccggaaggaacgacaactccatatgcagctctaccctggctggtctgcacgggat
aactacgggaagaagaagaagaggaaaagggataagcagccgggagagaccaatgaacac
agcgaatgtttcctaaatccttgcctttcacttcctccgattacaggagaaaaaaaaagt
gcgttcgctacatacaaggtgaaggcagctgcctcagcccaccctcttcagatggaagct
tactag

KEGG   Trichechus manatus latirostris (Florida manatee): 101350837
Entry
101350837         CDS       T05135                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: transcription factor 7
  KO
K02620  transcription factor 7
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04310  Wnt signaling pathway
tmu04390  Hippo signaling pathway
tmu04520  Adherens junction
tmu04550  Signaling pathways regulating pluripotency of stem cells
tmu04916  Melanogenesis
tmu04934  Cushing syndrome
tmu05132  Salmonella infection
tmu05165  Human papillomavirus infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05200  Pathways in cancer
tmu05210  Colorectal cancer
tmu05213  Endometrial cancer
tmu05215  Prostate cancer
tmu05216  Thyroid cancer
tmu05217  Basal cell carcinoma
tmu05221  Acute myeloid leukemia
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101350837
   04390 Hippo signaling pathway
    101350837
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101350837
   04550 Signaling pathways regulating pluripotency of stem cells
    101350837
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101350837
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101350837
  09162 Cancer: specific types
   05210 Colorectal cancer
    101350837
   05225 Hepatocellular carcinoma
    101350837
   05226 Gastric cancer
    101350837
   05216 Thyroid cancer
    101350837
   05221 Acute myeloid leukemia
    101350837
   05217 Basal cell carcinoma
    101350837
   05215 Prostate cancer
    101350837
   05213 Endometrial cancer
    101350837
   05224 Breast cancer
    101350837
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101350837
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101350837
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101350837
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101350837
   05165 Human papillomavirus infection
    101350837
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tmu03000]
    101350837
Transcription factors [BR:tmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    101350837
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 101350837
NCBI-ProteinID: XP_023594757
UniProt: A0A2Y9RJY3
LinkDB
Position
Unknown
AA seq 493 aa
MPQLDSGGGSAGGGDDLGAPDELLAFQDEGEEQDKSRDSAAGPERDLAELKSSLVNESEG
AAGGAGVPGAGAEAEVRAEALGREHASQRLFSDKLPESLEDGLKAPECASGMYKETVYSA
FNLLMHYPPPAGAGQHPQPQPPLHNKASQPPHGVPQLSPLYEHFSSPHPTPAPADISQKQ
VHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGK
QELQPYDRSLKTQAEAKVEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQI
LGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESNTDPGS
PKKCRARFGLNQQTDWCGPCRRKKKCIRYLPGEGRCPSPVPSDDSALGCPGSPAPQDSPS
YLLLPHFPTELLASPAERRLHHQVSPPLSASSPLGPHGPPAAPCRVHKYSYRNLTDRQPS
RPKTLGLLQEPTP
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgccgcagctggactcgggcgggggcagcgcgggcggcggcgacgacctcggcgcgccg
gacgagctgctggccttccaggacgagggcgaggagcaagacaagagccgcgacagcgcc
gcgggccccgagcgcgacctggccgagctcaagtcgtcactcgtcaacgaatccgagggc
gcggccggtggcgcgggggtcccgggggccggcgccgaggccgaggtccgggccgaggcg
ctcgggcgggaacacgcttcgcagagacttttctcggacaaacttccagagtctctggag
gacggcctgaaggccccagagtgtgctagcggcatgtacaaagagaccgtctactcagcc
ttcaatctgctcatgcactacccacctcccgcgggagcagggcagcacccccagccgcag
cccccgctgcacaacaaggctagtcagccccctcacggcgtcccccaactctctcctctc
tacgaacatttcagcagcccacaccccacacctgcgcctgctgacatcagccagaagcaa
gttcacaggcctctgcagacccctgacctctctggcttctactctctgacctcaggcagc
atgggacagctcccccacactgtgagctggttcacccacccatccctgatgctaggctct
ggtgtacctgggcaccccgcggccatcccccacccggccattgtgcccccctcagggaag
caggaactgcagccctatgaccgcagcctgaagacccaggcagaggccaaggtggagaag
gaggccaagaagccaaccatcaagaagccactgaatgccttcatgctgtacatgaaggag
atgagagccaaggtcatcgcagagtgcacgctcaaggaaagcgccgccatcaaccagatc
ctgggacgcaggtggcacgcgctgtctcgggaagaacaagccaagtattatgagctggcc
cgcaaagagaggcagctgcacatgcagctctacccaggctggtcggcgcgggacaactac
ggaaagaagaagaggcgctcaagggaaaagcaccaagaatccaacacagaccctggctcg
cctaagaaatgccgtgctcgctttggcctcaaccagcagacggattggtgtggtccgtgc
aggaggaaaaagaaatgcattcggtacttacccggagaaggccgctgccccagcccagtt
ccttccgatgacagtgctctaggctgccccgggtccccagcccctcaggactcaccctca
tacctcctgctgccccacttccccacagaactgcttgctagccctgcggagcggcgccta
catcaccaggtctctccgccgctctcagcctccagccccctgggcccccacgggccccct
gcagcaccctgcagagtacacaagtacagctacaggaatctcacagataggcagcctagc
aggcccaagacacttggcctcctccaggagcccaccccctga

DBGET integrated database retrieval system