KEGG   Trichechus manatus latirostris (Florida manatee): 101342008
Entry
101342008         CDS       T05135                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X2
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01522  Endocrine resistance
tmu01524  Platinum drug resistance
tmu04012  ErbB signaling pathway
tmu04066  HIF-1 signaling pathway
tmu04068  FoxO signaling pathway
tmu04110  Cell cycle
tmu04115  p53 signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04218  Cellular senescence
tmu04630  JAK-STAT signaling pathway
tmu04921  Oxytocin signaling pathway
tmu04928  Parathyroid hormone synthesis, secretion and action
tmu04934  Cushing syndrome
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05163  Human cytomegalovirus infection
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05169  Epstein-Barr virus infection
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05203  Viral carcinogenesis
tmu05205  Proteoglycans in cancer
tmu05206  MicroRNAs in cancer
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05212  Pancreatic cancer
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05216  Thyroid cancer
tmu05217  Basal cell carcinoma
tmu05218  Melanoma
tmu05219  Bladder cancer
tmu05220  Chronic myeloid leukemia
tmu05222  Small cell lung cancer
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101342008
   04630 JAK-STAT signaling pathway
    101342008
   04066 HIF-1 signaling pathway
    101342008
   04068 FoxO signaling pathway
    101342008
   04151 PI3K-Akt signaling pathway
    101342008
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101342008
   04115 p53 signaling pathway
    101342008
   04218 Cellular senescence
    101342008
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101342008
   04928 Parathyroid hormone synthesis, secretion and action
    101342008
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101342008
   05202 Transcriptional misregulation in cancer
    101342008
   05206 MicroRNAs in cancer
    101342008
   05205 Proteoglycans in cancer
    101342008
   05203 Viral carcinogenesis
    101342008
  09162 Cancer: specific types
   05210 Colorectal cancer
    101342008
   05212 Pancreatic cancer
    101342008
   05225 Hepatocellular carcinoma
    101342008
   05226 Gastric cancer
    101342008
   05214 Glioma
    101342008
   05216 Thyroid cancer
    101342008
   05220 Chronic myeloid leukemia
    101342008
   05217 Basal cell carcinoma
    101342008
   05218 Melanoma
    101342008
   05211 Renal cell carcinoma
    101342008
   05219 Bladder cancer
    101342008
   05215 Prostate cancer
    101342008
   05213 Endometrial cancer
    101342008
   05224 Breast cancer
    101342008
   05222 Small cell lung cancer
    101342008
   05223 Non-small cell lung cancer
    101342008
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101342008
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101342008
   05161 Hepatitis B
    101342008
   05160 Hepatitis C
    101342008
   05163 Human cytomegalovirus infection
    101342008
   05167 Kaposi sarcoma-associated herpesvirus infection
    101342008
   05169 Epstein-Barr virus infection
    101342008
   05165 Human papillomavirus infection
    101342008
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101342008
   01522 Endocrine resistance
    101342008
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 101342008
NCBI-ProteinID: XP_004379467
UniProt: A0A2Y9DSH9
LinkDB
Position
Unknown
AA seq 164 aa
MSEPSGDIPQIPCSSKVCRRLFGPVDEEQLRRDCDALMADCLQEARARWNFDFVTETPLE
GNYAWEPVQGLGLPKFYLPPGPRGAWDDLGGGKRPCTSTVLLQGMAQGDHVDLSLSCTLV
PHSPERPEVSPGGPGAPRGRKRGQTSMTDFYHSKRRLVFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcggagccgtcaggggacatccctcagatcccatgcagcagcaaggtgtgtcgccgc
ctcttcggccccgttgatgaagagcagctgcgccgagactgtgatgcgctaatggcggac
tgtttgcaagaggcccgtgcacgttggaacttcgactttgtcaccgagacaccgctggag
ggcaactatgcctgggagcctgtgcagggccttggcctgccgaagttctacctgcctcca
gggcctcggggggcctgggacgacctgggagggggcaagcggccctgcacctcaactgtc
ttgcttcaggggatggcccaaggggaccacgtggacctatcgctgtcctgtaccctcgtg
cctcattcccctgagcggcctgaagtgtccccaggtgggcctggtgcacctcggggccgg
aagcggggacagaccagcatgacagatttctaccactccaaacgtcggctggtcttctcc
aagaggaagccttaa

DBGET integrated database retrieval system