KEGG   Trichechus manatus latirostris (Florida manatee): 101342476
Entry
101342476         CDS       T05135                                 

Definition
(RefSeq) histone deacetylase 2 isoform X1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04110  Cell cycle
tmu04213  Longevity regulating pathway - multiple species
tmu04330  Notch signaling pathway
tmu04613  Neutrophil extracellular trap formation
tmu04919  Thyroid hormone signaling pathway
tmu05016  Huntington disease
tmu05031  Amphetamine addiction
tmu05034  Alcoholism
tmu05165  Human papillomavirus infection
tmu05169  Epstein-Barr virus infection
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05203  Viral carcinogenesis
tmu05206  MicroRNAs in cancer
tmu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101342476
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101342476
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101342476
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101342476
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    101342476
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101342476
   05202 Transcriptional misregulation in cancer
    101342476
   05206 MicroRNAs in cancer
    101342476
   05203 Viral carcinogenesis
    101342476
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    101342476
  09164 Neurodegenerative disease
   05016 Huntington disease
    101342476
  09165 Substance dependence
   05031 Amphetamine addiction
    101342476
   05034 Alcoholism
    101342476
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101342476
   05165 Human papillomavirus infection
    101342476
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tmu03036]
    101342476
Enzymes [BR:tmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101342476
Chromosome and associated proteins [BR:tmu03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     101342476
   HDAC complexes
    Sin3A-HDAC complex
     101342476
    BRAF-HDAC complex
     101342476
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101342476
  Chromatin remodeling factors
   NuRD complex
    101342476
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 101342476
NCBI-ProteinID: XP_004372537
UniProt: A0A2Y9DEC1
LinkDB
Position
Unknown
AA seq 488 aa
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKADVKEEDKSKDSSGEKTDTKGA
KSEQLSNP
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggcgtacagtcagggaggcggcaagaagaaagtctgttactactacgatggtgatatt
ggaaattactattatggacaaggtcatcctatgaaacctcatagaatccgcatgacccat
aacttgctcctaaattatggcttatatagaaaaatggaaatatatagaccccataaggcc
actgctgaagaaatgacaaaataccacagtgatgagtacatcaaatttctgcgttcaata
agaccagataacatgtctgagtatagtaaacagatgcagagatttaatgttggagaggat
tgcccagtgtttgatggactcttcgagttttgtcagctctcaactggtggctcagttgct
ggggctgtgaagttaaaccgacaacaaactgatatggctgttaactgggctggaggatta
catcatgctaagaagtcagaagcatcaggattctgttatgttaatgatattgtgcttgcc
atccttgaattgctaaagtatcatcagagagtcttatatattgatattgatatccatcat
ggtgatggtgttgaagaagctttttatacaacagatcgtgtaatgactgtatcattccat
aaatatggggaatactttcctggcactggagacttgagggacattggtgcaggaaaaggc
aaatactatgctgttaattttccaatgagagatggtatagatgatgagtcatatgggcag
atatttaagccgattatctcaaaagtgatggagatgtatcaacctagtgctgtggtatta
cagtgtggtgcagactcattatctggtgatagacttggttgcttcaatctaacagtcaaa
ggtcatgctaaatgtgtagaagttgtaaaaactttcaatttaccattactgatgcttgga
ggaggtggatacacaatccgtaacgttgctcgatgttggacttatgagactgcggttgcc
cttgattgtgagattcctaatgagttgccatataatgattactttgagtattttggaccg
gacttcaaactgcatattagcccatcaaacatgacaaaccagaacactccagaatatatg
gaaaaaataaaacagcgtttatttgaaaatttgcgcatgttacctcatgcaccgggtgtc
caaatgcaagctattccagaagatgctgttcatgaagatagtggagatgaagatggagaa
gatccagataagagaatttctattcgagcatcagataagcggatagcctgtgatgaagaa
ttctcagattctgaggatgaaggagaaggaggtcgtagaaatgtggctgatcataagaaa
ggagcaaagaaagctagaatcgaagaagacaagaaggaaacagaggataaaaaagcagat
gttaaagaagaagataaatccaaggacagtagcggtgaaaaaacagataccaaaggagcc
aaatcggaacagctcagcaacccttga

KEGG   Trichechus manatus latirostris (Florida manatee): 101357779
Entry
101357779         CDS       T05135                                 

Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04110  Cell cycle
tmu04213  Longevity regulating pathway - multiple species
tmu04330  Notch signaling pathway
tmu04613  Neutrophil extracellular trap formation
tmu04919  Thyroid hormone signaling pathway
tmu05016  Huntington disease
tmu05031  Amphetamine addiction
tmu05034  Alcoholism
tmu05165  Human papillomavirus infection
tmu05169  Epstein-Barr virus infection
tmu05200  Pathways in cancer
tmu05202  Transcriptional misregulation in cancer
tmu05203  Viral carcinogenesis
tmu05206  MicroRNAs in cancer
tmu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101357779
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101357779
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101357779
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101357779
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    101357779
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101357779
   05202 Transcriptional misregulation in cancer
    101357779
   05206 MicroRNAs in cancer
    101357779
   05203 Viral carcinogenesis
    101357779
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    101357779
  09164 Neurodegenerative disease
   05016 Huntington disease
    101357779
  09165 Substance dependence
   05031 Amphetamine addiction
    101357779
   05034 Alcoholism
    101357779
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101357779
   05165 Human papillomavirus infection
    101357779
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tmu03036]
    101357779
Enzymes [BR:tmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101357779
Chromosome and associated proteins [BR:tmu03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     101357779
   HDAC complexes
    Sin3A-HDAC complex
     101357779
    BRAF-HDAC complex
     101357779
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101357779
  Chromatin remodeling factors
   NuRD complex
    101357779
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 101357779
NCBI-ProteinID: XP_004372056
UniProt: A0A2Y9DCK6
LinkDB
Position
Unknown
AA seq 482 aa
MAQTVGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FRPVISKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVRNFNLPMLMLGG
GGYTIRNVARCWTYETAVALSTDIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPETKGVKEEVK
LA
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcgcagactgtgggcaccaagaggaaagtctgttactactacgacggggatgttgga
aattactattatggacaaggtcacccaatgaagccccatcgaatccgcatgactcacaat
ttgctgctcaactatggtctctaccgaaagatggaaatctatcgccctcacaaagccaat
gctgaggagatgaccaagtaccacagtgatgactacattaaattcttgcgctccatccgc
ccagacaacatgtccgagtacagcaagcagatgcaaagattcaacgttggtgaggactgt
ccagtatttgatggcctgtttgagttctgtcagttatctactggtggctctgtggcaagt
gctgtgaaacttaataagcagcagacggacatcgctgtgaattgggctgggggcctgcac
catgcaaagaagtccgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccacggt
gatggcgtggaagaggccttctataccacagaccgggtcatgactgtgtcctttcataag
tatggagagtacttcccaggaacaggggacttacgggatattggcgctggcaaaggcaag
tattatgcagttaactacccgctccgagatggaattgatgatgagtcctatgaggccatt
ttcaggccggtcatatccaaagtaatggagatgttccagcctagtgcagtcgtcttacag
tgtggctccgactccctatctggggatcgattaggttgtttcaatctgaccatcaaaggg
catgccaagtgtgtggaatttgtgaggaatttcaacctgccgatgctgatgctgggagga
ggtggctacaccattcgtaatgtcgcgcgatgctggacgtatgaaacagctgtggccctg
agcacagatatccctaacgagcttccatacaatgactactttgaatactttggaccagat
ttcaaacttcacatcagtccttccaatatgaccaaccagaacactaatgagtacttagag
aagatcaaacagagactatttgagaacctgagaatgttgccccatgcacctggggtccaa
atgcaggcaattcctgaggatgccatcccagaggaaagcggtgatgaggatgaagaggac
cctgacaaacgcatctcgatctgttcctctgacaaacgaattgcttgtgaagaagagttc
tctgactctgatgaggagggagagggtggccgcaagaactcttccaacttcaaaaaagcc
aagagagtcaaaacagaggatgaaaaagagaaagacccagaagagaagaaagaagtcaca
gaagaggagaaaaccaaggaggagaagcctgaaaccaaaggggtcaaggaggaggtcaag
ctggcctga

DBGET integrated database retrieval system