KEGG   Trichechus manatus latirostris (Florida manatee): 101342543
Entry
101342543         CDS       T05135                                 

Definition
(RefSeq) transforming growth factor beta-1 isoform X2
  KO
K13375  transforming growth factor beta-1
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04010  MAPK signaling pathway
tmu04060  Cytokine-cytokine receptor interaction
tmu04068  FoxO signaling pathway
tmu04110  Cell cycle
tmu04218  Cellular senescence
tmu04350  TGF-beta signaling pathway
tmu04380  Osteoclast differentiation
tmu04390  Hippo signaling pathway
tmu04659  Th17 cell differentiation
tmu04672  Intestinal immune network for IgA production
tmu04926  Relaxin signaling pathway
tmu04932  Non-alcoholic fatty liver disease
tmu04933  AGE-RAGE signaling pathway in diabetic complications
tmu05140  Leishmaniasis
tmu05142  Chagas disease
tmu05144  Malaria
tmu05145  Toxoplasmosis
tmu05146  Amoebiasis
tmu05152  Tuberculosis
tmu05161  Hepatitis B
tmu05166  Human T-cell leukemia virus 1 infection
tmu05200  Pathways in cancer
tmu05205  Proteoglycans in cancer
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05212  Pancreatic cancer
tmu05220  Chronic myeloid leukemia
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05321  Inflammatory bowel disease
tmu05323  Rheumatoid arthritis
tmu05410  Hypertrophic cardiomyopathy
tmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101342543
   04350 TGF-beta signaling pathway
    101342543
   04390 Hippo signaling pathway
    101342543
   04068 FoxO signaling pathway
    101342543
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101342543
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101342543
   04218 Cellular senescence
    101342543
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101342543
   04672 Intestinal immune network for IgA production
    101342543
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101342543
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101342543
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101342543
   05205 Proteoglycans in cancer
    101342543
  09162 Cancer: specific types
   05210 Colorectal cancer
    101342543
   05212 Pancreatic cancer
    101342543
   05225 Hepatocellular carcinoma
    101342543
   05226 Gastric cancer
    101342543
   05220 Chronic myeloid leukemia
    101342543
   05211 Renal cell carcinoma
    101342543
  09163 Immune disease
   05323 Rheumatoid arthritis
    101342543
   05321 Inflammatory bowel disease
    101342543
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101342543
   05414 Dilated cardiomyopathy
    101342543
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101342543
   04933 AGE-RAGE signaling pathway in diabetic complications
    101342543
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101342543
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101342543
   05161 Hepatitis B
    101342543
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101342543
   05144 Malaria
    101342543
   05145 Toxoplasmosis
    101342543
   05140 Leishmaniasis
    101342543
   05142 Chagas disease
    101342543
Chaperones and folding catalysts [BR:tmu03110]
 Intramolecular chaperones
  Others
   101342543
Cytokines and growth factors [BR:tmu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   101342543
Glycosaminoglycan binding proteins [BR:tmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101342543
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 101342543
NCBI-ProteinID: XP_004388797
UniProt: A0A2Y9E988
LinkDB
Position
Unknown
AA seq 391 aa
MPPSGLRLLPLLLPLLRLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVESHNKI
YEKLSHGSHSIYMLFNTSELREAVPEPVLLSRAELRLLRQSLKVEQHVELYQKYSNDSWR
YLSDRLLAPSESSEWLSFDVTGVVRQWLSHGGEIEGFRLSTHCSCDDKDSKLQVEIKGLN
NNQRRGDLAAIHGMNRPFLLLMATPLERAQHLHSSRHRRALDTSYCFSSTEKNCCVRQLY
IDFRKDLGWKWIHEPKGYHANFCLGPCPFIWSLDTQYSKVLALYNQYNPGASAAPCCVPQ
ALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgccgccctccgggctgcggctgctgccgctactgctgcctttgctacggctgctagtg
ctgacgccgggccggccggccgcggggctgtccacctgcaagaccatcgacatggagctg
gtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaaactgcggctcgcc
agccccccgagccagggggaggtgccgcccggcccgctgccagaggccgtgctcgccctc
tacaacagtacccgcgaccgagtggccggggagagcgctgagccggagccggagcccgag
gcggactactacgccaaggaggtcacccgcgtgctaatggtggaaagccacaacaaaatc
tatgagaaactcagtcatggctcacacagcatatatatgctcttcaacacgtcggagctt
cgagaagcagtgcctgaacccgttttgctttcccgggcagagctacgcctgctgaggcaa
agtttaaaagtggagcagcacgtggagctgtaccagaaatacagcaatgattcctggcgc
tacctcagcgaccgactgctggcccccagcgagtcgtcggagtggctgtccttcgatgtc
actggagttgtgcggcagtggctgagccacggaggggaaatagagggctttcgcctcagc
acccactgctcctgtgacgacaaagacagcaaactccaagtggaaatcaaagggctcaat
aacaaccagcgcaggggtgacctggcagccattcacggcatgaaccggcccttcctgctc
ctcatggccaccccgctggagagggcccagcacctgcacagctcccggcaccggcgggcc
ctggacaccagctactgcttcagctccacggagaagaactgctgcgtgcggcagctgtac
atcgacttccgcaaggacctgggctggaagtggatccatgagcccaagggctaccacgcc
aacttctgcctggggccctgccctttcatctggagcctcgacacccagtacagcaaggtc
ctggccctgtacaaccagtacaacccgggtgcgtcggcggcaccgtgctgcgtgccgcag
gcgctggagccgctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagctg
tccaacatgatcgtgcgatcctgcaagtgcagctga

KEGG   Trichechus manatus latirostris (Florida manatee): 101347669
Entry
101347669         CDS       T05135                                 

Definition
(RefSeq) transforming growth factor beta-2 isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04010  MAPK signaling pathway
tmu04060  Cytokine-cytokine receptor interaction
tmu04068  FoxO signaling pathway
tmu04110  Cell cycle
tmu04218  Cellular senescence
tmu04350  TGF-beta signaling pathway
tmu04380  Osteoclast differentiation
tmu04390  Hippo signaling pathway
tmu04933  AGE-RAGE signaling pathway in diabetic complications
tmu05140  Leishmaniasis
tmu05142  Chagas disease
tmu05144  Malaria
tmu05145  Toxoplasmosis
tmu05146  Amoebiasis
tmu05152  Tuberculosis
tmu05161  Hepatitis B
tmu05166  Human T-cell leukemia virus 1 infection
tmu05200  Pathways in cancer
tmu05205  Proteoglycans in cancer
tmu05206  MicroRNAs in cancer
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05212  Pancreatic cancer
tmu05220  Chronic myeloid leukemia
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05321  Inflammatory bowel disease
tmu05323  Rheumatoid arthritis
tmu05410  Hypertrophic cardiomyopathy
tmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101347669
   04350 TGF-beta signaling pathway
    101347669
   04390 Hippo signaling pathway
    101347669
   04068 FoxO signaling pathway
    101347669
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101347669
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101347669
   04218 Cellular senescence
    101347669
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101347669
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101347669
   05206 MicroRNAs in cancer
    101347669
   05205 Proteoglycans in cancer
    101347669
  09162 Cancer: specific types
   05210 Colorectal cancer
    101347669
   05212 Pancreatic cancer
    101347669
   05225 Hepatocellular carcinoma
    101347669
   05226 Gastric cancer
    101347669
   05220 Chronic myeloid leukemia
    101347669
   05211 Renal cell carcinoma
    101347669
  09163 Immune disease
   05323 Rheumatoid arthritis
    101347669
   05321 Inflammatory bowel disease
    101347669
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101347669
   05414 Dilated cardiomyopathy
    101347669
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101347669
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101347669
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101347669
   05161 Hepatitis B
    101347669
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101347669
   05144 Malaria
    101347669
   05145 Toxoplasmosis
    101347669
   05140 Leishmaniasis
    101347669
   05142 Chagas disease
    101347669
Cytokines and growth factors [BR:tmu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   101347669
Glycosaminoglycan binding proteins [BR:tmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101347669
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 101347669
NCBI-ProteinID: XP_004375986
UniProt: A0A2Y9DJX5
LinkDB
Position
Unknown
AA seq 442 aa
MHYCVLSAFLVLHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
DEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSETVCPV
VTTPSGSVGSLCSRQSQVLCGYLDAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVF
RLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKTPHLLLMLLPSYRLESQQSNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctggtgctgcatctggtcacggtggcgctgagc
ctgtctacctgcagcacgctcgatatggaccagtttatgcgcaagaggatcgaggcgatc
cgcgggcagatcctcagcaagctgaagctcaccagccccccagaagactatccggagccc
gacgaagtcccccctgaggtgatttccatctacaacagcaccagggacttgctccaggag
aaagcgagccggcgagctgccgcctgcgagcgcgagaggagcgacgaggagtactacgcc
aaggaggtttacaaaatcgacatgccgcccttcttcccctccgaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttgtgttccagacagtcccaggtgctctgt
gggtaccttgacgccatcccgcccactttctacagaccctacttcagaattgtccgattc
gatgtctcagcgatggagaagaatgcttccaatttggtgaaagcagagttcagagtcttt
cgtttgcagaacccaaaagccagagtgcctgaacaacggatagaactgtatcagattctg
aaatccaaagatttaacatccccaacccagcgctacatcgacagcaaagtcgtgaaaaca
agagctgaaggcgaatggctctcctttgatgtaactgacgctgttcatgaatggcttcac
cataaagacaggaacctgggatttaaaataagtttgcactgtccgtgctgtacctttgta
ccatccaacaattacatcatcccaaataaaagcgaagagctagaagcaagatttgcaggt
attgatggcacctccacatataccagtggtgatcagaaaactataaagtccactaggaaa
aaaaacagtgggaagaccccacatctcctgctaatgttgttgccctcctacagacttgag
tcacaacagtccaaccggcggaagaagcgtgccctggatgccgcctattgctttagaaat
gtgcaggataattgctgcctacgtccactttacattgatttcaagagggatcttgggtgg
aaatggatacatgaacctaaagggtacaatgctaacttctgtgctggcgcgtgcccatat
ttgtggagttcagacactcagcacagtagggtcctcagcttatataataccatcaatcca
gaagcatctgcttctccgtgctgtgtgtcccaggatttagaaccgctaaccattctctac
tacatcggcaaaacacccaagatcgaacagctttctaatatgatcgtgaagtcttgcaaa
tgcagctaa

KEGG   Trichechus manatus latirostris (Florida manatee): 101358028
Entry
101358028         CDS       T05135                                 

Definition
(RefSeq) transforming growth factor beta-3
  KO
K13377  transforming growth factor beta-3
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04010  MAPK signaling pathway
tmu04060  Cytokine-cytokine receptor interaction
tmu04068  FoxO signaling pathway
tmu04110  Cell cycle
tmu04218  Cellular senescence
tmu04350  TGF-beta signaling pathway
tmu04390  Hippo signaling pathway
tmu04933  AGE-RAGE signaling pathway in diabetic complications
tmu05140  Leishmaniasis
tmu05142  Chagas disease
tmu05144  Malaria
tmu05145  Toxoplasmosis
tmu05146  Amoebiasis
tmu05152  Tuberculosis
tmu05161  Hepatitis B
tmu05166  Human T-cell leukemia virus 1 infection
tmu05200  Pathways in cancer
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05212  Pancreatic cancer
tmu05220  Chronic myeloid leukemia
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05321  Inflammatory bowel disease
tmu05323  Rheumatoid arthritis
tmu05410  Hypertrophic cardiomyopathy
tmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101358028
   04350 TGF-beta signaling pathway
    101358028
   04390 Hippo signaling pathway
    101358028
   04068 FoxO signaling pathway
    101358028
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101358028
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101358028
   04218 Cellular senescence
    101358028
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101358028
  09162 Cancer: specific types
   05210 Colorectal cancer
    101358028
   05212 Pancreatic cancer
    101358028
   05225 Hepatocellular carcinoma
    101358028
   05226 Gastric cancer
    101358028
   05220 Chronic myeloid leukemia
    101358028
   05211 Renal cell carcinoma
    101358028
  09163 Immune disease
   05323 Rheumatoid arthritis
    101358028
   05321 Inflammatory bowel disease
    101358028
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101358028
   05414 Dilated cardiomyopathy
    101358028
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101358028
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101358028
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101358028
   05161 Hepatitis B
    101358028
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101358028
   05144 Malaria
    101358028
   05145 Toxoplasmosis
    101358028
   05140 Leishmaniasis
    101358028
   05142 Chagas disease
    101358028
Cytokines and growth factors [BR:tmu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   101358028
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 101358028
NCBI-ProteinID: XP_004371116
UniProt: A0A2Y9DB88
LinkDB
Position
Unknown
AA seq 457 aa
MHLLAKPQSSGSGEAAWFSSLLLHVCWGLLLARRHRPPASLPGSHMKMHLQRALVVLALL
NFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPSLMTHVPYQVLALYNS
TRELLEEMQGEKEEGCTQENTESEYYAKEIHKFDMIQGLAEHNELAVCPKGITSKVFRFN
VSSVEKNRTNLFRAEFRVLRVPNPNSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTRG
TPEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENIHEVMEIKFKGVDN
EDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKRALDTNYCFRNLEENC
CVRALYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASAS
PCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgcaccttcttgccaagcctcagtcttcgggatctggggaggccgcctggttttcctcc
ctccttctgcacgtctgctggggtctgctcctcgccaggcgtcaccgccccccagcctct
cttccgggctcgcacatgaagatgcacttgcaaagggctctggtggtcctcgccctgctg
aactttgccacggtcagcctctctctgtccacttgcaccaccttggacttcggccacatc
aagaagaagagggtggaagccattaggggacagattttgagcaagctcaggctcaccagc
ccccctgagccatcgttgatgacccatgtcccctaccaggtcctggccctttacaacagc
acccgggagctgctggaggagatgcagggggaaaaggaggaaggctgcactcaggaaaac
accgagtcggaatactatgccaaagaaatccataaattcgacatgatccaggggctggcg
gagcacaatgagctggccgtctgtcccaaaggaatcacctccaaggttttccgcttcaac
gtatcctcagtggagaaaaatagaaccaacttgttccgagcagaattccgggtcctgcgg
gtgcccaaccccaactccaaacgcaatgagcagaggattgagctcttccagattcttcgg
ccagatgagcacatcgccaaacagcgctatattggtggcaagaatctgcccacacggggg
acccccgagtggttgtcttttgatgtcactgacactgtgcgtgagtggctcctgcgaaga
gaatccaacttaggtctggaaatcagcattcattgtccatgtcacacctttcagcccaat
ggggatatcctggaaaatattcatgaggtgatggaaatcaaattcaaaggtgtggacaat
gaagatgatcatggccgtggagacttggggcgcctcaagaagcagaaggatcaccacaac
cctcatctaatcctcatgatgattcccccacaccggctcgacaacccaggccagggaggg
cagaggaagaagcgggccctggacaccaattactgcttccgcaacttggaggagaactgc
tgtgtgcgcgctctctacattgacttccgacaggacctgggctggaaatgggtccatgaa
cctaagggctactacgccaacttctgctcaggcccttgcccatacctccgcagcgcagac
acaacccacagcacggtgctgggactgtacaacaccctgaatcctgaagcatctgcctca
ccttgttgtgtgccccaggacctggagcccctgaccatcctgtactatgtcgggaggacc
cccaaggtggagcagctctccaacatggtggtcaagtcctgtaagtgtagctga

DBGET integrated database retrieval system