KEGG   Trichechus manatus latirostris (Florida manatee): 101342556
Entry
101342556         CDS       T05135                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: high affinity immunoglobulin gamma Fc receptor I
  KO
K06498  high affinity immunoglobulin gamma Fc receptor I
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04145  Phagosome
tmu04380  Osteoclast differentiation
tmu04613  Neutrophil extracellular trap formation
tmu04640  Hematopoietic cell lineage
tmu04666  Fc gamma R-mediated phagocytosis
tmu05140  Leishmaniasis
tmu05150  Staphylococcus aureus infection
tmu05152  Tuberculosis
tmu05202  Transcriptional misregulation in cancer
tmu05221  Acute myeloid leukemia
tmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101342556
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101342556
   04613  Neutrophil extracellular trap formation
    101342556
   04666 Fc gamma R-mediated phagocytosis
    101342556
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101342556
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101342556
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101342556
  09163 Immune disease
   05322 Systemic lupus erythematosus
    101342556
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101342556
   05152 Tuberculosis
    101342556
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101342556
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tmu04131]
    101342556
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:tmu04090]
    101342556
Membrane trafficking [BR:tmu04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    101342556
CD molecules [BR:tmu04090]
 Proteins
  101342556
SSDB
Motif
Pfam: Ig_2 Ig_3 V-set ig I-set Ig_4 Ig_5
Other DBs
NCBI-GeneID: 101342556
NCBI-ProteinID: XP_023580361
UniProt: A0A2Y9QFQ3
LinkDB
Position
Unknown
AA seq 479 aa
MCIIPKISASNWGRWVQKYVNWKCILQELKISQKRNMMIVVRRGNFLPLFXSXLQNPLQN
PFNVWHVAGLTAPISCGDKMWLLTALLLSVPGGGQMDSPKAVITLRPPWVSVFQGESVTL
HCEGPGQPGNHSAQWFHNGSAIQTLTTNYSFTAASITDSGEYRCKTALSVWSDPVQLEIH
RSWLLLQVSSRVFTEGESLALRCHGWKNKLVYNVVFYQNGKAFMFSPYKSELTIQKTNLS
HSGVYHCSGKGNNQYMYRSAGVSISVKELFPAPVLRAFFSSPLLEGNPVNLTCQTQLSSQ
SPGLQLYFSFHVGSKNLMGRSTSSEYQILTAKYISAGPHWFLSSISHLGLSVSGLQPAVP
VWFHVFVYLTVGTVFLVDTVLCVTIQKKLQKKKKSNLQFSLAFGDGEKATSHPQKDSRVE
EALKCQEQEEQLLFGFQNGAYLPNEDASRTRLSWLRVAERPFNVHHLEHPQATWDSKSV
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgtgcataatcccaaaaatcagtgcttcaaactgggggaggtgggttcagaaatatgtg
aattggaagtgcatacttcaagaattgaagatttcccagaaaaggaacatgatgatagtg
gtcagaagaggcaatttccttcctcttttctaatcttaactccagaatcctctgcagaat
cccttcaatgtctggcatgttgcaggtctcactgctcccatcagctgtggagataagatg
tggcttttgactgctctgctcctttcggttccaggtggtggacaaatggactccccaaaa
gcagtgatcaccttgcgccctccgtgggtcagcgtgttccaaggggaaagtgtaacctta
cattgtgaggggccaggtcagcctggaaaccactcggcccagtggtttcacaatggctca
gccattcagaccctgacgaccaattacagcttcacggctgccagcatcactgacagtggt
gaatacaggtgcaagacagctctctcggtgtggagtgaccctgtgcagctggaaatccac
agaagttggctgctactacaggtctctagccgagtcttcactgaaggagaatctctggcc
ttgaggtgtcatggatggaagaataagctggtgtacaacgtggttttctatcaaaatggc
aaagcctttatgttttctccttacaaatctgaactcaccattcagaaaaccaacttgagt
cacagtggcgtctatcactgctcaggaaagggaaacaaccaatacatgtacagatcagcg
ggagtatctatctctgtgaaagagctatttccagccccagtgctgagagcattcttttca
tcccccctcctagaggggaatccagtgaacctgacctgtcaaacacagttgtcctcacag
agtcctggtttgcagctttacttctccttccacgtgggcagcaagaacctgatgggcagg
agcacatcctctgaataccagattctgactgccaaatatatctcagcggggccccactgg
tttctaagtagtatctctcatcttggtctttctgtttcaggcctgcagccagcagttcct
gtctggtttcatgtctttgtctatctgacggtgggaacagtatttttggtggacactgtt
ctttgcgtgacaatacagaagaaactccaaaagaagaaaaagtccaatttacaattctct
ttggcttttggcgatggggaaaaggcaacttctcaccctcagaaagacagccgtgtagag
gaagccctgaagtgtcaggaacaagaagaacagctgttatttggctttcaaaatggagct
tatctgccaaacgaggatgcatcccggactcgcctgtcttggctgcgtgtggcagagcgc
ccctttaacgtccaccacctagaacatcctcaagcaacttgggactcgaaatcggtgtga

DBGET integrated database retrieval system