KEGG   Trichechus manatus latirostris (Florida manatee): 101342651
Entry
101342651         CDS       T05135                                 

Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X3
  KO
K04692  signal transducer and activator of transcription 3
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu04062  Chemokine signaling pathway
tmu04066  HIF-1 signaling pathway
tmu04068  FoxO signaling pathway
tmu04217  Necroptosis
tmu04550  Signaling pathways regulating pluripotency of stem cells
tmu04630  JAK-STAT signaling pathway
tmu04659  Th17 cell differentiation
tmu04917  Prolactin signaling pathway
tmu04920  Adipocytokine signaling pathway
tmu04931  Insulin resistance
tmu04933  AGE-RAGE signaling pathway in diabetic complications
tmu04935  Growth hormone synthesis, secretion and action
tmu05145  Toxoplasmosis
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05162  Measles
tmu05163  Human cytomegalovirus infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05169  Epstein-Barr virus infection
tmu05200  Pathways in cancer
tmu05203  Viral carcinogenesis
tmu05205  Proteoglycans in cancer
tmu05206  MicroRNAs in cancer
tmu05212  Pancreatic cancer
tmu05221  Acute myeloid leukemia
tmu05223  Non-small cell lung cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tmu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101342651
   04066 HIF-1 signaling pathway
    101342651
   04068 FoxO signaling pathway
    101342651
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101342651
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101342651
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101342651
   04062 Chemokine signaling pathway
    101342651
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101342651
   04917 Prolactin signaling pathway
    101342651
   04935 Growth hormone synthesis, secretion and action
    101342651
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101342651
   05206 MicroRNAs in cancer
    101342651
   05205 Proteoglycans in cancer
    101342651
   05203 Viral carcinogenesis
    101342651
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101342651
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101342651
   05221 Acute myeloid leukemia
    101342651
   05223 Non-small cell lung cancer
    101342651
  09163 Immune disease
   05321 Inflammatory bowel disease
    101342651
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101342651
   04933 AGE-RAGE signaling pathway in diabetic complications
    101342651
  09172 Infectious disease: viral
   05162 Measles
    101342651
   05161 Hepatitis B
    101342651
   05160 Hepatitis C
    101342651
   05163 Human cytomegalovirus infection
    101342651
   05167 Kaposi sarcoma-associated herpesvirus infection
    101342651
   05169 Epstein-Barr virus infection
    101342651
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101342651
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101342651
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tmu03000]
    101342651
Transcription factors [BR:tmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    101342651
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 DUF4795 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 101342651
NCBI-ProteinID: XP_004390354
UniProt: A0A2Y9EAU0
LinkDB
Position
Unknown
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMDLTSECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctacagcagctcgacacacggtacctggagcagctgcatcag
ctgtacagtgacagcttcccgatggagctaaggcagtttctggccccttggattgagagt
caagattgggcatatgctgccagcaaagaatcacatgccactttggtgtttcataatctc
ttgggtgagattgaccagcagtatagccgctttctacaagagtcaaatgttctctatcag
cacaatctgcgaagaatcaagcagttccttcagagcagatatcttgagaagccaatggag
attgcccgaattgtggcccggtgcctgtgggaagagtcacgcctcctccaaactgcagcc
actgcagcccagcaagggggccaggccaaccaccccacagctgcagtggtaacggagaag
cagcagatgctagagcagcacctacaggatgttcggaagagggtacaggatctagaacag
aaaatgaaagtggtagagaacctccaggatgactttgatttcaactataaaaccctcaag
agtcaaggagacatgcaagatctgaatggaaacaaccagtcagtgaccaggcagaagatg
cagcagcttgaacagatgcttacggcgctggaccagatgcgaagaagcattgtgagtgag
ttggcagggcttttgtcagcaatggagtacgtgcagaaaactctcacggatgaagagctg
gctgactggaagaggaggcaacagattgcttgcattggaggccctcccaacatctgctta
gatcgtctagaaaactggataacctcattagcagaatctcaacttcagacccgccagcaa
attaagaaactggaagagttgcagcaaaaagtttcctacaaaggggaccccatagtacag
caccggccaatgctggaggagagaattgtagagctgtttagaaacttaatgaaaagtgcc
tttgtggttgagcggcagccctgcatgcccatgcatcctgaccggcccttggtcatcaag
accggtgtccagtttactactaaagtcaggttgttggtcaagttccctgagttaaattat
cagcttaaaattaaagtgtgcattgacaaagactctggggatgttgctgctctcagagga
tcccggaaattcaacattctgggcacaaacacgaaagtgatgaacatggaagaatccaac
aacggcagcctctctgcagaattcaagcacttgaccctgagggagcaaagatgtggcaat
gggggccgagcaaactgcgatgcctccctgattgtgactgaggagctgcacctgatcact
tttgagacagaggtatatcaccaaggcctcaaaatagacctggagactcactccttgcct
gttgtggtgatctccaatatttgtcagatgccaaatgcctgggcttccatcctgtggtat
aacatgctgaccaacaaccccaagaacgtgaactttttcaccaagcccccaattggaacc
tgggatcaagtggccgaggtgctgagctggcagttctcctccaccacaaagcgagggctg
agcattgagcaattgactacactggcggagaagctcttgggacctggtgtaaactactca
gggtgtcagatcacgtgggctaaattttgcaaagaaaacatggctggcaagggtttctcc
ttctgggtctggctggacaatatcattgaccttgtgaaaaagtacatcctggccctttgg
aatgaagggtacataatgggcttcatcagtaaggagcgggagcgggccatcttgagcacc
aagcccccaggcaccttcctgctaagattcagtgaaagcagcaaagaaggaggaatcacc
ttcacttgggtggagaaggacatcagcggtaagacccagatccagtccgtggaaccatat
accaaacagcagctgaacaacatgtcatttgctgaaatcatcatgggctataagatcatg
gatgccaccaacatcctggtgtctccgctggtctatctctaccctgacattcctaaagag
gaagcgtttggaaagtattgtcgaccagagagccaggagcaccctgaagctgacccaggt
agtgctgccccatacctgaagaccaagtttatctgtgtgacaccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaaggtgctgaaccctcagcaggagggcaatttgagtcccttacgtttgacatggac
ttgacctcggagtgtgctacctcgcccatgtga

DBGET integrated database retrieval system