KEGG   Trichechus manatus latirostris (Florida manatee): 101343059
Entry
101343059         CDS       T05135                                 

Definition
(RefSeq) CCAAT/enhancer-binding protein epsilon
  KO
K10051  CCAAT/enhancer binding protein (C/EBP), epsilon
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu05202  Transcriptional misregulation in cancer
tmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101343059
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101343059
Transcription factors [BR:tmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    101343059
SSDB
Motif
Pfam: bZIP_2 bZIP_1 Taxilin GAS Myc-LZ Nmad5 DUF2605 SBE2 Fib_alpha TSC22 Phlebovirus_NSM
Other DBs
NCBI-GeneID: 101343059
NCBI-ProteinID: XP_004389979
UniProt: A0A2Y9EA49
LinkDB
Position
Unknown
AA seq 281 aa
MSHGSYYECAPRGGQQPLEFSGGRAGPGDLGDMCEHEASIDLSAYIESGEEQLLSDLFAV
KPAPEARGLKGPGTLAFPHYLPPDPRSFAYPPHTFSQDRKALGPGIYSSPGNYDPRAVAV
KEEPRGPEGSRGAARSSYNPLQYQVAHCGQTAMHLPPALAAPSQPLRVLKAPLAAGAQPC
SPLLKAPSPAGPSHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYM
AENESLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS
NT seq 846 nt   +upstreamnt  +downstreamnt
atgtcccacgggtcctactatgagtgtgcgcccaggggaggccagcagccactcgagttt
tcagggggccgagcagggcctggggacctgggggacatgtgtgagcatgaggcctccatt
gacctctctgcctacattgagtctggggaggagcagctcctctcggacctctttgctgtg
aagccagcacctgaggcccgaggccttaagggccccggaacgcttgccttcccccactac
ctgccacctgaccctcggtcctttgcctaccctccacacaccttcagccaggacaggaag
gcattggggcctggcatctacagcagcccagggaactacgaccccagggctgtggccgtg
aaggaggaacctcgggggccagagggcagccgaggtgccgcccgcagcagctacaatccc
ctgcagtaccaagtggcacactgtgggcagacggccatgcacctgcccccggccctggct
gcacccagccaacccctgcgcgtcctcaaggcccctctggctgctggtgcacagccctgc
agccccctcctcaaagcgccctccccagctggcccctcgcacaagggcaagaaggcagtg
aacaaagacagcctggagtaccggctgcggcgtgagcgcaacaacatcgctgtgcgcaag
agccgggacaaggccaagaggcgcatcctggagacacagcagaaggtgctggagtacatg
gcagagaacgagagcctccgcagccgcgtggagcagctcacccaggagctggacaccctt
cgtaacctcttccgccagatccccgaggctgccaacctcatcaaaggtgtggggggctgc
agctga

DBGET integrated database retrieval system