KEGG   Trichechus manatus latirostris (Florida manatee): 101343139Help
Entry
101343139         CDS       T05135                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETD2 isoform X2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101343139
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tmu03036]
    101343139
Enzymes [BR:tmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101343139
Chromosome and associated proteins [BR:tmu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101343139
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET AWS WW
Motif
Other DBs
NCBI-GeneID: 101343139
NCBI-ProteinID: XP_004368524
UniProt: A0A2Y9D639
LinkDB All DBs
Position
Unknown
AA seq 2569 aa AA seqDB search
MKQLPSQTPPKMGDFYDPEHPTPEEEENEAKIENVQKTGFIKGPIFKGVASSRFLPKGTK
TKVNLEEQGRQKVSFSFSLTKKTLQNRFLTALGNEKQNDTPNSPAIPLQADSTPKIKVDI
GDTLSTTEESSLPKSRVELGKIHFKKHLLHVTSRPLLAATTAVTSPPPPTVPLPAVIAES
TTVDSPPPSPPPPPPPPQATTPSPPAPVTEPVALPHAPVTVLMTAPVPSPVDVTVRALKE
PPVSVVSESLEVDTKQDAVSNSSEEHITQNLNEQANIPSQKGDSHIGKEEEIPDSSRSSL
GSKKTGSKKKSLQSEGTFLGSESDEDSVRTSSSQRSHDLKFSASVEKERDAKKSLAPLKS
EDLGKSSRSKTERDDKYFSYSKLERDTRYISSRCRSDRERRRSRSRSRSDRSSRTSLSYS
RSERSHYYDSDRRYHRNSPYRERTRYSRPYTENRARESSDSEDEYKRTYSRRTSSHSSSY
RDLRTSSSYSKSDRDCKTESSYIETEKRGKYSSKLERESKRTSENEVLKRCCSPSNDVGF
RRGSSYSKHDNSASRYKVTPSKPIPKSDKFKNSFCCTELNEGIKQSHSFSLQTPCSKGSE
LRMINKIPEREKTGSPSPSNQLKDSPTFKKLDESLIFKSEFIGHDSHDSIKELDSLSKGK
YDQLRTYHPIELNINGSPGAESDLATFCTSKTETLLMSSDDSVTGSEVSPLIKACMLSSN
GFQNISRCKEKDLDATCMQHSKSESPFRETEPPVSPHQDKLVTLPVMVIDYSKTVVREPV
DKRVSCCKTKDSDVYYTSNDSNPSLCHSEAENIEPSVTKISSNSFMNVHLESKTVICDNR
NLTDQNSKFGCEEYKQSVGSTSSTSVNHFDDLCQPVGSSSIASSLQSLPPEIKADSLTHL
RCAENTSPVLDAVLMSKTSTEFLKHTGEETIVEVGSGLPDSRRGFSSWENRHNNGLSEKC
LQETQEEGNSRLPDRRRRSEISLDEGGRRHVRTSDDSEVVFSSCDLNLTMEDSDGVTYTV
KCDSSGHASEIVSTIHEDYSGSSESSSDESDSEDTDSDDSSIPRNRLQSVVVVPKNSTLP
MEETSPCSSRSSQSYRHCSDHWEDERLESRRHAYEEKFEVMANKTCPQTEKFFLHKGAEK
NPEISFTQSSRKQVDNHLPEIVHPQSDGVDSTSHTDVKSDPLGHPNSEEIVKVKIASRQQ
ELPVYSSDDFEDVPSKSRQQTTFPHRPDSRLGKMELSFSSSCEISLVDGFHSSEELRNLG
WDFSQAEKPTTTYQQPDSSYGACDGHKYQQSAEQYGGTHSYWQGNGYWDPRSAGRPPGTG
VVYDRIQGQVPDSLTDDREEEENWDQCGGSHFSSQSNKFLLSIQQKDRGSVQAPEISSNS
IKDCLAVNEKKDLTKNLEKNDMKDRGPLKKRRQELESDSESDGELQDRKKVRVEVAQGET
AATPGSALVGPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTERKKNKSHRDIKR
MQCECTPLSKEERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVIL
TEKKGWGLRAARDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIID
ATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQ
KCFCGSANCRGYLGGENRVSIRAAGGKMKKERSRKKDSVDGELEALMENGEGLSDKNQVL
SLSRLMVRIETLEQKLTCLELIQNTHSQSCLKSFLECHGLSLLWIWMAELGDGRESNQKL
QEEIIKTLEHLPIPTKNMLEESKVLPIIQRWSQTKTAVPQLSEGDGYSSENTSRAHTPLN
TPDPSTKLSTEADTETPKKLMFRRLKIISENSMDSAISDATSELEGKDGKEDLDQLENVP
IEEEEELQPQQLLTQQLPESRVDGEASVEVSKLPMSEPEADSEIEPKESNGTKLEEPIAE
ETPSQDEEEGVSDVESERSQEQPDKTVDISDLATKLLDSWKDLKEVYRIPKKSQTEKENT
ITERGRDAVGFRDQTAAPKTPNRSRERDPDKQIQNKEKRKRRGSLSPPSSAYERGTKRPD
DRYDTPTSKKKVRIKDRNKLSTEERRKLFEQEVAQREAQKQQQQMQNLGMTSPLPYDSLG
YNAPHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLVGHSAEP
LAAPPPVPVVTHVTAPVEVSSSQYVAQSDGVVHQDSSVAVLPVPAPGPVQGQNYGVWDSN
QQSVSSVQQQYSPAQSQATIYYQGQTCPAVYGVTSPYSQTTPPIVQSYAQSSLQYIQGQQ
IFTAHPQGVVVQPAATVTTIVAPGQPQPLQPPEMVVTNNLLDLPPPSPPKPKTIVLPPNW
KTARDPEGKIYYYHVITRQTQWDPPTWESPGDDASLEHEAEMDLGTPTYDENPMKTSKKP
KTAEADTSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHG
VMNKELKYCKNPEDLECNENVKHKTKEYIKKYMQKFGAVYKPKEDTELE
NT seq 7710 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagctgccgtcgcagacgcctccgaagatgggggatttctatgaccccgagcac
ccgacccctgaagaagaagaaaatgaggcaaagattgaaaatgtgcagaaaacaggtttc
atcaaaggaccaattttcaaaggtgttgcttctagtcgatttttgcccaaaggcaccaag
acaaaagttaatttggaggaacagggacgacagaaggtgtcattcagcttcagccttaca
aagaaaactttacagaatagatttctgactgcacttggaaatgaaaagcaaaatgatact
ccaaactccccggctatacctcttcaagcagattcgacccctaaaattaaagtggacatt
ggagatactttatctactacagaagaatcttccctaccaaaatcaagggtggaattggga
aaaattcatttcaaaaaacatctacttcacgtaacatccaggccactgctggctgctacc
acagcagtaacatctccacctcctcccacagtaccattaccagcagttatagcagaatcg
acaactgtcgactcaccacccccatctccacctccaccacctccacctccccaagccaca
acaccctcaccaccagcgccagtaacagagccagtggccttgccacatgcaccagtaaca
gttctgatgacagcaccagtgccctcaccagtagatgtaacagttagagccctgaaagaa
ccaccagtttcagttgtatcagaatctttagaagtggacactaagcaggacgctgtatct
aatagttcagaagaacacataactcaaaatttgaatgagcaagcaaatattccctcacaa
aaaggagattcccatattgggaaggaagaagaaattccagatagttctagaagtagtcta
ggctctaagaaaacaggttctaagaagaaatctttacagtctgagggcacctttcttggt
tcagaatctgatgaagattctgtacggacttcctcaagtcagaggtcacatgatttaaaa
ttttcagcaagcgttgaaaaggaaagagatgcaaaaaagagcttagcacctttgaaaagt
gaggatttagggaaatcttcacgatctaaaacagagagagatgataaatattttagctac
tcaaaacttgaaagagatactcggtatatatcttcccgatgtagatcagacagagagcga
aggcggagcaggtctcgttctagatctgacagaagctctagaactagtttatcctattct
cgatcagaacgatcccattattacgattctgatcgtcgctaccataggaactccccttat
cgagagaggacacgctattctcggccatatacagagaacagggcaagagagagttctgac
tcagaagatgagtataagaggacatactcaaggcgtacctcatctcattcctcctcttac
agagacctaaggacatcatcatcctattctaaatctgatcgggactgcaaaactgagtcc
tcgtacatagagacagagaaaagaggaaaatattcttcaaaactagagagagaatccaaa
aggacttcagaaaatgaagttttgaaaaggtgttgttctccctctaatgatgtgggattc
cgacgggggtcatcatattctaagcatgataacagtgcttctcgttataaagttacccct
tcaaaacctatacccaagtctgataaatttaaaaattctttctgttgtacagaattaaat
gagggaatcaaacaatctcattcttttagtttacagactccttgttcaaaaggtagtgaa
ttaagaatgattaataaaattcctgaaagagaaaagaccgggtctccatcaccatcaaat
cagttaaaggattcacctacttttaaaaagctagatgaatcacttatttttaagtctgaa
tttataggacatgatagccatgatagtattaaggaattagactctttgtctaaagggaag
tatgatcaattaagaacttatcatcccatagaactaaatataaatggatctcctggagca
gaatctgatttggcaacattttgcacttctaaaactgagactcttttaatgtcttctgat
gatagtgtgactggatcagaggtatcccctttgatcaaagcatgcatgctttcatcaaat
ggatttcagaatattagtagatgtaaagaaaaagacttggatgctacttgcatgcagcat
agtaagtcagaaagcccatttagagaaacagaacctccagtgtcaccacaccaagataaa
ctcgtgacattgccagttatggtgatagattattccaaaacagtagttagagagccagtt
gataagagagtttcttgctgcaaaaccaaagattcagatgtatactatacttcaaatgac
agcaacccttctttgtgtcattctgaagctgaaaatattgagccttcagttacgaagatt
tcttccaatagctttatgaatgttcatttggagtcaaaaacagttatatgtgataataga
aatctgacagatcagaactcaaagtttggatgtgaagaatataagcagagcgttggtagc
actagttcaacttctgttaatcattttgatgatttatgccaacctgtagggagttccagt
attgcctcatctcttcagagtcttccaccagaaataaaagcagacagtttaactcacttg
cggtgtgcagagaacacatctccagttttggatgctgtgctgatgagtaaaacaagcaca
gagtttttaaaacacacaggggaagaaacaatagtagaagtgggtagtggccttcctgat
tcaagaaggggattttcttcctgggaaaacaggcataataatgggctgtctgagaagtgt
ttgcaagagactcaagaagaaggaaattccaggttacctgatagaagaagaagatcagaa
atctctttagatgaaggaggaagaagacatgtgcgtacttctgatgattcagaagttgta
ttttcttcttgtgatttgaatttaaccatggaagacagtgatggtgtaacttacaccgta
aaatgtgacagtagtggccacgcctcagaaattgtgtctactatccatgaagattattct
ggatcttctgaaagttcaagtgatgaaagtgattcagaagatacagattctgatgatagc
agtattccaagaaaccgtctccagtctgttgtggttgtgccaaagaattctactttgcct
atggaagaaacaagtccttgttcttctcggagcagtcagagttacagacactgttccgac
cactgggaagatgagagattggagtcaagaagacatgcatatgaggaaaaatttgaagtt
atggcaaataaaacctgtcctcaaactgagaagttctttcttcataaaggagcagagaag
aacccagaaatctcttttacacagtccagcagaaaacaagtggataaccacctgcctgaa
attgttcatcctcagagtgatggggttgatagtacaagtcatacagatgtgaaatctgac
cctctgggtcatccaaattcagaggaaatagtaaaagtcaaaatagcttctaggcaacaa
gaactgccagtttattcttctgatgattttgaagatgttccaagtaagtctcggcaacag
actactttccctcacaggccagatagtaggctggggaaaatggagttgagtttttcttcc
tcttgtgagatctctctagttgatggctttcactcatcagaagagctcagaaacttaggg
tgggacttctctcaagcagaaaagcctactaccacatatcagcaacctgacagcagctat
ggagcttgtgatggacacaagtatcagcaaagtgcagaacagtatggtgggacacatagt
tactggcaaggtaatggctactgggatccaagatcagcaggtagacctcctggaactgga
gttgtgtatgaccgaattcaagggcaagtaccagattccctaacagatgaccgtgaagag
gaggagaattgggatcaatgtggtggatcccacttttcaagccaatcaaataaatttctt
ctgtccattcagcagaaggacaggggatcagtgcaagcacctgaaataagcagcaattcc
attaaggactgtttagctgtaaatgagaagaaagatcttacaaaaaacttagagaaaaat
gacatgaaagatagaggacctcttaaaaaaaggaggcaggaattggagagtgattctgaa
agtgatggtgagcttcaggacagaaagaaagttagagtagaggtagcgcagggagagaca
gcagcaaccccaggctctgcactagttggaccttcctgtgtcatggatgacttcagggac
cctcagcgatggaaggagtgtgccaagcaggggaagatgccttgttactttgatcttatt
gaagaaaatgtttatttaacagaaagaaagaagaataaatcccatcgggatattaagcga
atgcagtgtgagtgtacgcctctttctaaagaagaaagagctcaaggtgaaatagcatgc
ggggaagattgtcttaatcgtctccttatgattgaatgttcttctcggtgtccaaatggg
gattattgttccaatagacggtttcagagaaaacagcatgcagatgtggaagtcatactc
acagaaaagaaaggctggggcttgagagcagccagagatctaccttcgaacacctttgtc
ctggaatattgtggagaggtacttgatcataaagagtttaaagcccgggtgaaggagtac
gcgcgaaataaaaacattcactactatttcatggccctgaagaatgatgagataatagat
gctactcagaaaggaaattgctcacgtttcatgaatcacagctgtgagccaaactgtgag
actcaaaaatggactgtgaatggacaactgagagttgggttttttaccaccaaactggtt
ccttcaggatcagagttaacatttgactatcagttccaaagatatggaaaagaggctcag
aaatgtttctgtgggtcagctaattgccgaggttacctgggaggagagaacagagtcagc
attcgagcagcaggagggaaaatgaagaaggagcgatcccgtaagaaggattcagtggat
ggagagcttgaagctctgatggaaaatggtgaaggtctctcggataaaaaccaggtgctc
agcttatcccgcctgatggttagaattgaaactttggagcagaaacttacctgtcttgag
ctcatacagaacacacactcacagtcctgcctaaaatcctttctggaatgtcatggactg
tctttgctgtggatctggatggcagagctaggtgatggccgggaaagtaaccagaagctt
caggaagagattataaagactttggaacacttgcccattcctactaaaaatatgctggaa
gaaagcaaagtacttccaatcattcagcgttggtctcagaccaagaccgctgtccctcag
ttgagtgaaggagatgggtattctagtgagaacacatcacgtgctcacacaccactcaac
acacctgatccttctaccaagcttagcacggaagctgacacagaaacccccaagaagctc
atgtttcgtagactgaaaattataagtgaaaatagcatggatagtgcgatttctgatgct
accagtgaactagaaggcaaggatggcaaagaggaccttgaccagttagaaaatgtcccc
atagaggaagaggaagagttgcaaccacaacagctactcacacaacagctgcctgaatcc
agagttgatggtgaagcttcagtggaggtcagtaagctacccatgtctgaaccagaggct
gacagtgaaatagagcccaaagagagcaatggcacaaaactagaagaacctattgctgag
gaaacaccatcccaagatgaagaggaaggtgtgtctgatgtggagagtgaaaggagccag
gaacagccagataaaacagtggatataagtgatttggccaccaagctcctggacagttgg
aaagacctaaaggaggtataccgaattccaaagaagagtcaaactgaaaaggagaacaca
ataactgaacgaggaagggatgctgttggcttcagagatcaaacagctgccccaaagact
cctaacaggtcaagagagagagacccagacaagcaaattcaaaataaagagaaaaggaaa
cgaaggggctccctctcaccaccctcttctgcttatgagcggggaacaaaaaggccagat
gacagatatgatacaccaacttctaaaaagaaagtacgaattaaagaccgcaataaactt
tctacagaggagcgccggaagttatttgagcaagaggtggctcaacgagaggctcagaaa
caacagcagcagatgcagaacctaggaatgacatctcccctgccctatgactctcttggc
tacaatgcccctcatcacccctttgctggctacccaccaggttatcccatgcaagcctat
gtggatcccagcaaccctaatgctggaaaggtgctcctgcccacacccagcatggaccct
gtgtgctctcctgctccttatgatcatgctcagcccttggtgggacattctgcagaaccc
cttgctgcccctccaccagtgccagtggtgacacatgtgacagcccctgtggaagtttcc
agttcacagtatgtggcccagagcgatggtgtggtacaccaagactccagtgtcgctgtt
ttgccagtgccggccccaggcccagtccagggacagaattatggtgtttgggattcaaac
caacagtctgtcagcagcgtacagcagcagtactctcctgcacagtctcaagcaaccata
tattatcaaggtcagacatgtccagctgtctatggtgtgacatcaccttattcacagaca
actccaccaattgtacagagttatgcgcaatcaagtcttcagtatatccagggacaacag
attttcacagctcacccacaaggagtggtggtacagccagctgcaaccgtgactacaatt
gttgcaccagggcagcctcagcccttacagccacctgaaatggttgtgacaaataatctc
ctggatttgccacctccttctcctcccaaaccaaaaaccatcgtcttacctcccaactgg
aagacagcccgagatcctgaagggaagatttattactaccatgtcatcacaaggcagact
cagtgggatcctcctacttgggaaagcccgggagatgatgccagccttgagcatgaagct
gagatggacctaggaaccccaacttatgacgaaaaccccatgaagacctcgaaaaagccc
aagacagcagaagcagacacatccagtgagctggccaaaaaaagcaaagaagtattcaga
aaagagatgtcccagttcattgtccagtgcctgaacccttaccggaaacctgactgcaaa
gtgggaagaattaccacaactgaagacttcaaacacctggctcgcaagctgacacatggc
gttatgaataaagagctgaagtactgtaagaaccctgaggacctggagtgcaatgagaat
gtgaaacacaaaaccaaggagtacatcaagaagtacatgcagaaatttggggctgtttac
aaacccaaagaggacactgaattggagtga

DBGET integrated database retrieval system