KEGG   Trichechus manatus latirostris (Florida manatee): 101343214
Entry
101343214         CDS       T05135                                 

Definition
(RefSeq) ras association domain-containing protein 1 isoform X3
  KO
K09850  Ras association domain-containing protein 1
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04014  Ras signaling pathway
tmu04390  Hippo signaling pathway
tmu04392  Hippo signaling pathway - multiple species
tmu05200  Pathways in cancer
tmu05206  MicroRNAs in cancer
tmu05219  Bladder cancer
tmu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101343214
   04390 Hippo signaling pathway
    101343214
   04392 Hippo signaling pathway - multiple species
    101343214
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101343214
   05206 MicroRNAs in cancer
    101343214
  09162 Cancer: specific types
   05219 Bladder cancer
    101343214
   05223 Non-small cell lung cancer
    101343214
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Mst1_SARAH
Other DBs
NCBI-GeneID: 101343214
NCBI-ProteinID: XP_004368618
UniProt: A0A2Y9D6D5
LinkDB
Position
Unknown
AA seq 353 aa
MSAEPELIELRELAPAQGAGPGRARLERANALRIAPGTTRNPARHLAPGRGHRFQPAGPT
THTWCDLCGDFIWGVVRKGLQCAREGSSASRPGLSADCKFTCHYRCRALVSLDCCGPRDL
GWEPALERDTNVDEPVEWETPDLSQAEVEQKIKEYNSQINSNLFMSLNKDGSYTGFIKVQ
LKLVRPVSVPSSKKPPSLQDARRSPVRGTAVRRRTSFYLPKDAVKHLHVLSRTQAREVIE
ALLRKFLVVDDPRKFALFERAERHGQVYLRKLSDDEQPLRLRLLAGPSEKALSFVLKEND
SGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSCCRQKIQEALHACPLG
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgtcagcggagcctgagcttatcgagctgcgggagctggcacccgcacagggcgccggc
ccgggccgcgcccgcctagagcgcgccaacgcgctgcgcatcgcgccaggcaccacgcgc
aaccccgcaaggcatctggccccgggccgcggccaccgcttccagcccgccgggcccacc
acgcacacgtggtgcgacctctgcggcgacttcatctggggcgtcgtgcgcaagggcctg
cagtgcgcgcgtgagggatcctccgcctcacggcccggcctttccgcagactgcaagttc
acttgccactaccgctgccgcgcactcgtcagtctggactgctgcggaccccgcgacctg
ggctgggagccggcgctggagcgggacacgaacgtggatgagcccgtggagtgggagaca
ccggacctttctcaggctgaggttgagcagaagatcaaggagtacaacagccagatcaat
agcaacctctttatgagcttgaacaaggacggctcctacacaggcttcatcaaggttcag
ctgaagctggtgcgccctgtctcagtgccctccagcaagaagccaccctccctgcaggat
gcccggcggagcccagtgcggggcactgctgtgaggcgccgcacctccttctacctgcct
aaggatgctgtcaagcacctgcacgtgctgtcgcgcacacaagcacgtgaggtcattgag
gccctgctgcgcaagttcttggtggtggacgacccccgcaagtttgcactctttgagcgg
gctgagcgccacggccaagtgtacctgcggaagctgtcagatgatgagcagcccctgcga
ctgcggctcctcgcagggcccagtgagaaggccctgagctttgtcctaaaggagaacgac
tctggagaggtgaattgggatgccttcagcatgcctgaactgcacaacttcctgcgcatc
ctgcagcgagaggaggaggagcaccttcgccagatcctgcagaagtattcctgttgccgc
cagaagatccaggaggctctgcatgcctgccccctggggtga

DBGET integrated database retrieval system