KEGG   Trichechus manatus latirostris (Florida manatee): 101343418Help
Entry
101343418         CDS       T05135                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04010  MAPK signaling pathway
tmu04064  NF-kappa B signaling pathway
tmu04210  Apoptosis
tmu04380  Osteoclast differentiation
tmu04625  C-type lectin receptor signaling pathway
tmu04660  T cell receptor signaling pathway
tmu04668  TNF signaling pathway
tmu04672  Intestinal immune network for IgA production
tmu05166  Human T-cell leukemia virus 1 infection
tmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101343418
   04064 NF-kappa B signaling pathway
    101343418
   04668 TNF signaling pathway
    101343418
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101343418
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101343418
   04660 T cell receptor signaling pathway
    101343418
   04672 Intestinal immune network for IgA production
    101343418
  09158 Development
   04380 Osteoclast differentiation
    101343418
 09160 Human Diseases
  09167 Infectious diseases
   05166 HTLV-I infection
    101343418
   05169 Epstein-Barr virus infection
    101343418
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101343418
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     101343418
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: STE group
  Other
   101343418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 101343418
NCBI-ProteinID: XP_004374329
LinkDB All DBs
Position
Unknown
AA seq 947 aa AA seqDB search
MAVMEMACPGTPGSAVGQQKELAKAKEKAQTVGKNQSSMCKLKASEKSSVFCGKWDILND
VITKGTAKEGSEGGLAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSDSLDQIPNN
VAHATEGKMAPVCWKGKRRSKARKKRKKKSSKALAQAGVALAKPLPRTPEQESCTVPVQE
DESPLGSSYVRNTPQFIKPLQEPSLGQLCFKKLGEGLRPALPRSEFHKLISPLQCLNHVW
KLHHPQDVGPLPQPVHPFPYSRLPHPFPFHPLQPWKPHPLESFLSKLACADGQQPLPGPH
LGKLACIDSQKPLPGPHQKPSCPSRGTCEKFSVEEYLVHALQGSVSSGQAHSLASLAKTW
SAGGPRMQGPSPETEDSEGVLLNEKLKPVDYEYREEIHWATHQPRLGRGSFGEVHRMEDK
QTGFQCAVKKVRIEVFRAEELVACAGLTSPRIVPLYGAVKEGPWVSIFMELLEGGSLGQL
IKQKGCLPEDRALYYLGQALEGLEYLHTRRILHGDVKADNVLLSSDGSRAALCDFGHAVC
LQPDGLGNSLLTGDYIPGTETHMAPEVVMGKPCDAKVDIWSSCCMMLHMLNGCHPWTQYF
RGPLCLKIASEPPPVKEIPPSCAPLTAQAIQEGLRKEPIHRASAVELGGKVSLALQQVGG
LKSPWRGEYKEPRHLPPNQPNYHQTFCAQPRELSLGAPGPQPAEDTADGAPKLQPPLPPE
PPERNKSPALNLSKEESGTWEPLPLSSLDPAPVKSPSSPERRATFPEQELQQLEIELFLN
SLSQPFSLEEQEQILSCLSVDSLSLSDDSEKNPSKASQSSRDTLSSGVHSWSSQAEARSS
SWNMVLARGRPTDTPSHFNGVKVQIQSLNGEHLHIREFHRVKVGDIATGISSQIPAAAFS
LVTKDGQPVRYDMEVPDSGIDLQCTLAPDGSFAWSWRVKHGQLENRP
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatggaaatggcctgtccaggcacccctggctcggcagtcgggcagcagaag
gagctcgccaaagccaaggagaaggcgcagacagtggggaagaatcaaagctccatgtgc
aagcttaaggcctcagagaagagctccgtgttctgcgggaagtgggatatcctgaacgat
gtgattaccaaaggcacagccaaggaaggctccgagggaggactggctgccatctccatc
attgcccaggccgaatgtgagaatagccaagagttcagtcccaccttttcagaacgaatt
ttcatcgctgggtccaaacagtacagccagtctgatagtcttgatcaaatccccaacaat
gtggcccatgcaactgagggcaaaatggcccctgtatgttggaagggaaagcggcgcagc
aaagcccggaagaaacggaagaagaagagctcgaaggccctggctcaggcgggagtggcc
ttggccaaacctctccccaggacccccgagcaggagagctgcacagtcccggtgcaggag
gatgagtctccactaggctcctcatatgttagaaacacaccccagtttatcaagcctctg
caggagccaagccttggccaactatgttttaagaaactcggggagggcctgcggccagca
cttcctcgatcagaattccacaagctgatcagccccctgcaatgtctgaaccatgtgtgg
aaactccaccacccccaggatgtgggccccctgccccaacccgttcaccccttcccctac
agcagactgccccatcccttcccattccaccctctccagccctggaaacctcaccccctg
gagtccttcctgagcaaactggcatgtgcagatggccagcagcccctgcctggcccacac
ctgggcaagttggcatgtatagacagtcagaagcccctgcctggcccacaccagaagccc
agctgtccatcacgtggtacctgtgagaagttttctgtggaggaatacctggtacacgct
ctgcagggcagtgtgagctcaggccaggcccacagcctggccagcctggccaagacctgg
tcggcagggggccccaggatgcagggacccagccccgaaactgaggacagcgagggagtc
ctgcttaatgagaaactcaagccggtggattatgagtaccgagaggagattcactgggcc
acacaccagccccgcctgggcagaggctccttcggagaggtacacaggatggaggacaag
cagactggcttccagtgtgctgtcaaaaaggtgcgaattgaagtgtttagggcagaggag
ttggtggcatgtgcaggattgacctctcccagaattgtccctttgtatggtgctgtgaag
gaaggtccttgggtcagcatcttcatggaactgctggaaggtggctccctaggccagctc
ataaagcagaagggatgtctgccagaggaccgggccctttactacctgggccaggccttg
gaggggctggaatacctgcatacacgaaggattctgcatggagatgtcaaagctgacaat
gtgctcctgtccagcgacgggagccgcgcagccctctgcgacttcggccatgctgtgtgc
cttcaacctgatggtctggggaattccttacttacaggggactacatccccggcacagag
acccacatggctccagaggtggtgatgggcaagccctgtgatgctaaggtggacatctgg
agcagctgctgcatgatgctgcacatgcttaatggctgccatccttggactcagtacttc
cgagggccactctgcctcaagattgccagcgagcccccacctgtgaaggagatcccacct
tcctgtgctcctctcactgcccaggccatccaagaggggctgaggaaggagcccatccac
agagcatctgcggtggagctggggggcaaggtcagcctggcactgcagcaagtgggaggt
ctgaagagcccttggaggggagaatataaagaaccaagacatctgccaccaaaccaaccg
aactatcaccagaccttctgcgcccagccaagggagctctcgctaggggccccagggccc
cagccagctgaggacacagcagacggggctcctaagctccagcctcctctaccaccagag
cccccagagcggaacaagtctccagccctgaacttgagcaaggaggagtctgggacatgg
gaacccttgcctctgtcctccctggacccagcccctgtcaaaagccccagctcaccagag
cgcagggcaaccttccctgagcaggaactgcagcagctggaaatagaattatttctgaac
agtctgtcccagccattctctctggaggagcaggagcagatcctgtcgtgcctcagcgtc
gacagcctctccctgtcagatgacagtgagaagaacccatcaaaggcctctcagagctcg
cgggacaccctgagttccggcgtgcactcatggagcagccaggcagaggctcgcagctct
agctggaacatggtgctggcccgggggcggcccacagataccccgagccatttcaatggt
gtgaaagtccaaatacagtccctcaatggcgaacacctgcacatccgggagttccaccgt
gtcaaggtgggagacatcgcgactggcatcagcagccagatcccggctgcagcgttcagc
ttggtgaccaaggatgggcagcccgtgcgctatgacatggaggtaccagactcgggcatt
gacctgcagtgcaccctggcccccgatggcagctttgcctggagctggagggtcaagcat
ggccagctggagaacaggccctag

DBGET integrated database retrieval system